Detailed information of TA system TA249663

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 49283..49552
• Replicon: plasmid plas2
• Accession: NZ_CP099882
• Organism: Escherichia albertii strain 233_2_GWG_B

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NIZ21_RS24395
• Protein ID: WP_001372321.1
• Coordinates: 49427..49552 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	49283..49348 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NIZ21_RS24350	44352..44579	+	228	WP_071594011.1	hypothetical protein	-
NIZ21_RS24355	44820..45026	+	207	WP_000547971.1	hypothetical protein	-
NIZ21_RS24360	45052..45591	+	540	WP_000290812.1	single-stranded DNA-binding protein	-
NIZ21_RS24365	45653..45886	+	234	WP_000006030.1	DUF905 family protein	-
NIZ21_RS24370	45951..47909	+	1959	WP_000117210.1	ParB/RepB/Spo0J family partition protein	-
NIZ21_RS24375	47964..48398	+	435	WP_000845873.1	conjugation system SOS inhibitor PsiB	-
NIZ21_RS24380	48395..49157	+	763	Protein_52	plasmid SOS inhibition protein A	-
NIZ21_RS24385	49126..49314	-	189	WP_001299721.1	hypothetical protein	-
-	49126..49350	+	225	NuclAT_0	-	-
-	49126..49350	+	225	NuclAT_0	-	-
-	49126..49350	+	225	NuclAT_0	-	-
-	49126..49350	+	225	NuclAT_0	-	-
-	49283..49348	-	66	-	-	Antitoxin
NIZ21_RS24390	49336..49485	+	150	Protein_54	plasmid maintenance protein Mok	-
NIZ21_RS24395	49427..49552	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NIZ21_RS24400	49772..50002	+	231	WP_256876178.1	hypothetical protein	-
NIZ21_RS24405	50000..50173	-	174	Protein_57	hypothetical protein	-
NIZ21_RS24410	50243..50449	+	207	WP_000547971.1	hypothetical protein	-
NIZ21_RS24415	50474..50761	+	288	WP_000107535.1	hypothetical protein	-
NIZ21_RS24420	50881..51702	+	822	WP_001234469.1	DUF932 domain-containing protein	-
NIZ21_RS24425	51999..52646	-	648	WP_256876177.1	transglycosylase SLT domain-containing protein	-
NIZ21_RS24430	52923..53306	+	384	WP_000124979.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NIZ21_RS24435	53497..54183	+	687	WP_000332493.1	PAS domain-containing protein	-
NIZ21_RS24440	54279..54506	+	228	WP_001254385.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	espL2	1..89091	89091

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T249663 WP_001372321.1 NZ_CP099882:49427-49552 [Escherichia albertii]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT249663 NZ_CP099882:c49348-49283 [Escherichia albertii]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin