Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 49126..49552 | Replicon | plasmid plas2 |
| Accession | NZ_CP099882 | ||
| Organism | Escherichia albertii strain 233_2_GWG_B | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | NIZ21_RS24395 | Protein ID | WP_001372321.1 |
| Coordinates | 49427..49552 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 49126..49350 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ21_RS24350 (44352) | 44352..44579 | + | 228 | WP_071594011.1 | hypothetical protein | - |
| NIZ21_RS24355 (44820) | 44820..45026 | + | 207 | WP_000547971.1 | hypothetical protein | - |
| NIZ21_RS24360 (45052) | 45052..45591 | + | 540 | WP_000290812.1 | single-stranded DNA-binding protein | - |
| NIZ21_RS24365 (45653) | 45653..45886 | + | 234 | WP_000006030.1 | DUF905 family protein | - |
| NIZ21_RS24370 (45951) | 45951..47909 | + | 1959 | WP_000117210.1 | ParB/RepB/Spo0J family partition protein | - |
| NIZ21_RS24375 (47964) | 47964..48398 | + | 435 | WP_000845873.1 | conjugation system SOS inhibitor PsiB | - |
| NIZ21_RS24380 (48395) | 48395..49157 | + | 763 | Protein_52 | plasmid SOS inhibition protein A | - |
| NIZ21_RS24385 (49126) | 49126..49314 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - (49126) | 49126..49350 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (49126) | 49126..49350 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (49126) | 49126..49350 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (49126) | 49126..49350 | + | 225 | NuclAT_0 | - | Antitoxin |
| NIZ21_RS24390 (49336) | 49336..49485 | + | 150 | Protein_54 | plasmid maintenance protein Mok | - |
| NIZ21_RS24395 (49427) | 49427..49552 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| NIZ21_RS24400 (49772) | 49772..50002 | + | 231 | WP_256876178.1 | hypothetical protein | - |
| NIZ21_RS24405 (50000) | 50000..50173 | - | 174 | Protein_57 | hypothetical protein | - |
| NIZ21_RS24410 (50243) | 50243..50449 | + | 207 | WP_000547971.1 | hypothetical protein | - |
| NIZ21_RS24415 (50474) | 50474..50761 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| NIZ21_RS24420 (50881) | 50881..51702 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| NIZ21_RS24425 (51999) | 51999..52646 | - | 648 | WP_256876177.1 | transglycosylase SLT domain-containing protein | - |
| NIZ21_RS24430 (52923) | 52923..53306 | + | 384 | WP_000124979.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| NIZ21_RS24435 (53497) | 53497..54183 | + | 687 | WP_000332493.1 | PAS domain-containing protein | - |
| NIZ21_RS24440 (54279) | 54279..54506 | + | 228 | WP_001254385.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | espL2 | 1..89091 | 89091 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T249662 WP_001372321.1 NZ_CP099882:49427-49552 [Escherichia albertii]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT249662 NZ_CP099882:49126-49350 [Escherichia albertii]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|