Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2862001..2862226 Replicon chromosome
Accession NZ_CP099880
Organism Escherichia albertii strain 233_2_GWG_B

Toxin (Protein)


Gene name hokW Uniprot ID A0A7L6L988
Locus tag NIZ21_RS14185 Protein ID WP_000813269.1
Coordinates 2862001..2862156 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2862168..2862226 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ21_RS14140 2857286..2857783 - 498 WP_001135262.1 lysozyme RrrD -
NIZ21_RS14145 2857783..2857998 - 216 WP_000839574.1 class II holin family protein -
NIZ21_RS14160 2858798..2859616 - 819 WP_256876231.1 CPBP family intramembrane metalloprotease -
NIZ21_RS14165 2859759..2860127 - 369 WP_059217965.1 antiterminator Q family protein -
NIZ21_RS14170 2860120..2860497 - 378 WP_059274539.1 RusA family crossover junction endodeoxyribonuclease -
NIZ21_RS14175 2860498..2861553 - 1056 WP_105210958.1 DUF968 domain-containing protein -
NIZ21_RS14180 2861555..2861833 - 279 WP_059274501.1 hypothetical protein -
NIZ21_RS14185 2862001..2862156 - 156 WP_000813269.1 type I toxin-antitoxin system toxin HokD Toxin
- 2862168..2862226 + 59 - - Antitoxin
NIZ21_RS14190 2862417..2862500 - 84 Protein_2775 ORF6N domain-containing protein -
NIZ21_RS14195 2862762..2863535 + 774 WP_256876232.1 alpha/beta hydrolase -
NIZ21_RS14200 2863891..2864301 - 411 WP_059274497.1 DUF977 family protein -
NIZ21_RS14205 2864309..2865070 - 762 WP_059274498.1 DUF1627 domain-containing protein -
NIZ21_RS14210 2865094..2865840 - 747 WP_059274499.1 ATP-binding protein -
NIZ21_RS14215 2865847..2866809 - 963 WP_105210960.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - espM2 / espM2 / espW 2831545..2879098 47553


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5722.86 Da        Isoelectric Point: 6.1531

>T249649 WP_000813269.1 NZ_CP099880:c2862156-2862001 [Escherichia albertii]
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT249649 NZ_CP099880:2862168-2862226 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7L6L988

Antitoxin

Download structure file

References