Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 635399..636126 | Replicon | chromosome |
| Accession | NZ_CP099877 | ||
| Organism | Escherichia albertii strain 247_2_EW_B | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | NIZ22_RS03125 | Protein ID | WP_000550189.1 |
| Coordinates | 635399..635713 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NIZ22_RS03130 | Protein ID | WP_000560272.1 |
| Coordinates | 635710..636126 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ22_RS03105 (631558) | 631558..632544 | - | 987 | WP_000617693.1 | Gfo/Idh/MocA family oxidoreductase | - |
| NIZ22_RS03110 (632623) | 632623..633315 | - | 693 | WP_059215025.1 | vancomycin high temperature exclusion protein | - |
| NIZ22_RS03115 (633392) | 633392..633895 | - | 504 | WP_059215024.1 | M48 family metallopeptidase | - |
| NIZ22_RS03120 (633980) | 633980..635116 | + | 1137 | WP_059241776.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| NIZ22_RS03125 (635399) | 635399..635713 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| NIZ22_RS03130 (635710) | 635710..636126 | + | 417 | WP_000560272.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| NIZ22_RS03135 (636216) | 636216..638234 | - | 2019 | WP_059216457.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| NIZ22_RS03140 (638459) | 638459..640810 | - | 2352 | WP_059235423.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T249616 WP_000550189.1 NZ_CP099877:635399-635713 [Escherichia albertii]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14993.40 Da Isoelectric Point: 4.3697
>AT249616 WP_000560272.1 NZ_CP099877:635710-636126 [Escherichia albertii]
MIAIADILQAGEKLTDVAPFLAGIQSEEQYAQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMVQAMPGG
VAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLNGKRKLTLEHAKKLAARFGISPALFID
MIAIADILQAGEKLTDVAPFLAGIQSEEQYAQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMVQAMPGG
VAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLNGKRKLTLEHAKKLAARFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|