Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3917619..3917877 | Replicon | chromosome |
| Accession | NZ_CP099874 | ||
| Organism | Escherichia albertii strain 251_2_EW_B | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | NIZ23_RS19090 | Protein ID | WP_000809168.1 |
| Coordinates | 3917725..3917877 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 3917619..3917676 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ23_RS19075 | 3913426..3914673 | - | 1248 | WP_059235056.1 | hypothetical protein | - |
| NIZ23_RS19080 | 3914827..3916320 | - | 1494 | WP_256875787.1 | sulfatase-like hydrolase/transferase | - |
| NIZ23_RS19085 | 3916341..3917102 | - | 762 | WP_001276206.1 | outer membrane protein OmpK | - |
| - | 3917619..3917676 | - | 58 | - | - | Antitoxin |
| NIZ23_RS19090 | 3917725..3917877 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| NIZ23_RS19095 | 3917985..3919115 | - | 1131 | WP_001118445.1 | molecular chaperone DnaJ | - |
| NIZ23_RS19100 | 3919204..3921120 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| NIZ23_RS19105 | 3921495..3921899 | + | 405 | WP_000833521.1 | DUF2541 family protein | - |
| NIZ23_RS19110 | 3921926..3922639 | + | 714 | WP_001102345.1 | acidic protein MsyB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T249602 WP_000809168.1 NZ_CP099874:3917725-3917877 [Escherichia albertii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT249602 NZ_CP099874:c3917676-3917619 [Escherichia albertii]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|