Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 166075..166332 Replicon chromosome
Accession NZ_CP099874
Organism Escherichia albertii strain 251_2_EW_B

Toxin (Protein)


Gene name hokA Uniprot ID V0YDF1
Locus tag NIZ23_RS00745 Protein ID WP_001135738.1
Coordinates 166180..166332 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 166075..166123 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ23_RS00725 161305..162300 - 996 WP_059235567.1 acyltransferase -
NIZ23_RS00730 162473..162772 + 300 WP_000979961.1 YsaB family lipoprotein -
NIZ23_RS00735 162868..163779 + 912 WP_001168544.1 glycine--tRNA ligase subunit alpha -
NIZ23_RS00740 163789..165858 + 2070 WP_059235569.1 glycine--tRNA ligase subunit beta -
- 166075..166123 - 49 - - Antitoxin
NIZ23_RS00745 166180..166332 + 153 WP_001135738.1 type I toxin-antitoxin system toxin HokA Toxin
NIZ23_RS00750 166309..166380 - 72 WP_212734940.1 hypothetical protein -
NIZ23_RS00755 166520..166732 - 213 WP_000014594.1 RNA chaperone/antiterminator CspA -
NIZ23_RS00760 167015..167305 - 291 WP_000455794.1 HTH-type transcriptional regulator -
NIZ23_RS00765 167728..168438 + 711 WP_002460072.1 DUF3053 domain-containing protein -
NIZ23_RS00770 168491..169465 - 975 WP_059235571.1 glyoxylate/hydroxypyruvate reductase GhrB -
NIZ23_RS00775 169569..170228 - 660 WP_000747625.1 OmpA family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(5-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5912.14 Da        Isoelectric Point: 7.7173

>T249588 WP_001135738.1 NZ_CP099874:166180-166332 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE

Download         Length: 153 bp

Antitoxin


Download         Length: 49 bp

>AT249588 NZ_CP099874:c166123-166075 [Escherichia albertii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LX93

Antitoxin

Download structure file

References