Detailed information of TA system TA249583

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 52610..53036
• Replicon: plasmid plas1
• Accession: NZ_CP099872
• Organism: Escherichia albertii strain 253_2_EW_B

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NIZ24_RS23060
• Protein ID: WP_001372321.1
• Coordinates: 52911..53036 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	52610..52834 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NIZ24_RS23010 (47674)	47674..47892	+	219	WP_071588970.1	hypothetical protein	-
NIZ24_RS23015 (47829)	47829..48062	+	234	WP_071588969.1	hypothetical protein	-
NIZ24_RS23020 (48304)	48304..48510	+	207	WP_000547968.1	hypothetical protein	-
NIZ24_RS23025 (48536)	48536..49075	+	540	WP_009426937.1	single-stranded DNA-binding protein	-
NIZ24_RS23030 (49137)	49137..49370	+	234	WP_000006030.1	DUF905 family protein	-
NIZ24_RS23035 (49435)	49435..51393	+	1959	Protein_51	ParB/RepB/Spo0J family partition protein	-
NIZ24_RS23040 (51448)	51448..51882	+	435	WP_032217500.1	conjugation system SOS inhibitor PsiB	-
NIZ24_RS23045 (51879)	51879..52641	+	763	Protein_53	plasmid SOS inhibition protein A	-
NIZ24_RS23050 (52610)	52610..52798	-	189	WP_001336239.1	hypothetical protein	-
- (52610)	52610..52834	+	225	NuclAT_0	-	Antitoxin
- (52610)	52610..52834	+	225	NuclAT_0	-	Antitoxin
- (52610)	52610..52834	+	225	NuclAT_0	-	Antitoxin
- (52610)	52610..52834	+	225	NuclAT_0	-	Antitoxin
NIZ24_RS23055 (52820)	52820..52969	+	150	Protein_55	plasmid maintenance protein Mok	-
NIZ24_RS23060 (52911)	52911..53036	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NIZ24_RS23065 (53256)	53256..53486	+	231	WP_001426396.1	hypothetical protein	-
NIZ24_RS23070 (53484)	53484..53657	-	174	Protein_58	hypothetical protein	-
NIZ24_RS23075 (53727)	53727..53933	+	207	WP_000547971.1	hypothetical protein	-
NIZ24_RS23080 (53958)	53958..54244	+	287	Protein_60	hypothetical protein	-
NIZ24_RS23085 (54362)	54362..55183	+	822	WP_227479334.1	DUF932 domain-containing protein	-
NIZ24_RS23090 (55480)	55480..56127	-	648	WP_000614935.1	transglycosylase SLT domain-containing protein	-
NIZ24_RS23095 (56404)	56404..56787	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NIZ24_RS23100 (56978)	56978..57664	+	687	WP_256878428.1	PAS domain-containing protein	-
NIZ24_RS23105 (57759)	57759..57986	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	iucA / iucB / iucC / iucD / iutA / gspG / gspH / gspL / vat / espL2 / espL2 / espL2	1..145531	145531

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T249583 WP_001372321.1 NZ_CP099872:52911-53036 [Escherichia albertii]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT249583 NZ_CP099872:52610-52834 [Escherichia albertii]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGTCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin