Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symER/SymE(toxin) |
| Location | 3989853..3990265 | Replicon | chromosome |
| Accession | NZ_CP099871 | ||
| Organism | Escherichia albertii strain 253_2_EW_B | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | - |
| Locus tag | NIZ24_RS19400 | Protein ID | WP_256878049.1 |
| Coordinates | 3989924..3990265 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | symR | ||
| Locus tag | - | ||
| Coordinates | 3989853..3989929 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ24_RS19390 (3986737) | 3986737..3988326 | + | 1590 | WP_256878047.1 | type I restriction-modification system methyltransferase | - |
| NIZ24_RS19395 (3988323) | 3988323..3989696 | + | 1374 | WP_256878048.1 | restriction endonuclease subunit S | - |
| - (3989853) | 3989853..3989929 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (3989853) | 3989853..3989929 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (3989853) | 3989853..3989929 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (3989853) | 3989853..3989929 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (3989853) | 3989853..3989929 | - | 77 | NuclAT_9 | - | Antitoxin |
| - (3989853) | 3989853..3989929 | - | 77 | NuclAT_9 | - | Antitoxin |
| - (3989853) | 3989853..3989929 | - | 77 | NuclAT_9 | - | Antitoxin |
| - (3989853) | 3989853..3989929 | - | 77 | NuclAT_9 | - | Antitoxin |
| NIZ24_RS19400 (3989924) | 3989924..3990265 | + | 342 | WP_256878049.1 | endoribonuclease SymE | Toxin |
| NIZ24_RS19405 (3990312) | 3990312..3991478 | - | 1167 | WP_077696034.1 | DUF1524 domain-containing protein | - |
| NIZ24_RS19410 (3991532) | 3991532..3992408 | - | 877 | Protein_3788 | DUF262 domain-containing protein | - |
| NIZ24_RS19415 (3992633) | 3992633..3992806 | + | 174 | Protein_3789 | GntR family transcriptional regulator | - |
| NIZ24_RS19420 (3992959) | 3992959..3993891 | - | 933 | WP_256878050.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12414.23 Da Isoelectric Point: 7.8219
>T249579 WP_256878049.1 NZ_CP099871:3989924-3990265 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTTQPPATEESE
LMQSLRQVCKLSARKQKQVQEFIGVITGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTTQPPATEESE
LMQSLRQVCKLSARKQKQVQEFIGVITGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT249579 NZ_CP099871:c3989929-3989853 [Escherichia albertii]
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|