Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 595977..596776 | Replicon | chromosome |
Accession | NZ_CP099871 | ||
Organism | Escherichia albertii strain 253_2_EW_B |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | NIZ24_RS02940 | Protein ID | WP_000347251.1 |
Coordinates | 595977..596441 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | - |
Locus tag | NIZ24_RS02945 | Protein ID | WP_059250714.1 |
Coordinates | 596441..596776 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ24_RS02910 (590978) | 590978..591412 | - | 435 | WP_044709898.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
NIZ24_RS02915 (591430) | 591430..592308 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NIZ24_RS02920 (592298) | 592298..593077 | - | 780 | WP_097755477.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NIZ24_RS02925 (593088) | 593088..593561 | - | 474 | WP_001132991.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NIZ24_RS02930 (593584) | 593584..594864 | - | 1281 | WP_059216469.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NIZ24_RS02935 (595113) | 595113..595922 | + | 810 | WP_059250716.1 | aga operon transcriptional regulator AgaR | - |
NIZ24_RS02940 (595977) | 595977..596441 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NIZ24_RS02945 (596441) | 596441..596776 | - | 336 | WP_059250714.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NIZ24_RS02950 (596925) | 596925..598496 | - | 1572 | WP_025238276.1 | galactarate dehydratase | - |
NIZ24_RS02955 (598867) | 598867..600201 | + | 1335 | WP_025238277.1 | galactarate/glucarate/glycerate transporter GarP | - |
NIZ24_RS02960 (600217) | 600217..600987 | + | 771 | WP_025238278.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T249568 WP_000347251.1 NZ_CP099871:c596441-595977 [Escherichia albertii]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|