Detailed information of TA system TA249560

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 43362..43788
• Replicon: plasmid plas1
• Accession: NZ_CP099869
• Organism: Escherichia albertii strain 254_1_EW_B

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NIZ25_RS23765
• Protein ID: WP_001372321.1
• Coordinates: 43362..43487 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	43564..43788 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NIZ25_RS23720 (38410)	38410..38637	-	228	WP_001254385.1	conjugal transfer relaxosome protein TraY	-
NIZ25_RS23725 (38731)	38731..39417	-	687	WP_000332493.1	PAS domain-containing protein	-
NIZ25_RS23730 (39608)	39608..39991	-	384	WP_000124979.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NIZ25_RS23735 (40268)	40268..40915	+	648	WP_256876177.1	transglycosylase SLT domain-containing protein	-
NIZ25_RS23740 (41212)	41212..42033	-	822	WP_001234469.1	DUF932 domain-containing protein	-
NIZ25_RS23745 (42153)	42153..42440	-	288	WP_000107535.1	hypothetical protein	-
NIZ25_RS23750 (42465)	42465..42671	-	207	WP_000547971.1	hypothetical protein	-
NIZ25_RS23755 (42741)	42741..42914	+	174	Protein_48	hypothetical protein	-
NIZ25_RS23760 (42912)	42912..43142	-	231	WP_256876178.1	hypothetical protein	-
NIZ25_RS23765 (43362)	43362..43487	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NIZ25_RS23770 (43429)	43429..43578	-	150	Protein_51	plasmid maintenance protein Mok	-
- (43564)	43564..43788	-	225	NuclAT_0	-	Antitoxin
- (43564)	43564..43788	-	225	NuclAT_0	-	Antitoxin
- (43564)	43564..43788	-	225	NuclAT_0	-	Antitoxin
- (43564)	43564..43788	-	225	NuclAT_0	-	Antitoxin
NIZ25_RS23775 (43600)	43600..43788	+	189	WP_001299721.1	hypothetical protein	-
NIZ25_RS23780 (43757)	43757..44519	-	763	Protein_53	plasmid SOS inhibition protein A	-
NIZ25_RS23785 (44516)	44516..44950	-	435	WP_000845873.1	conjugation system SOS inhibitor PsiB	-
NIZ25_RS23790 (45005)	45005..46963	-	1959	WP_000117210.1	ParB/RepB/Spo0J family partition protein	-
NIZ25_RS23795 (47028)	47028..47261	-	234	WP_000006030.1	DUF905 family protein	-
NIZ25_RS23800 (47323)	47323..47862	-	540	WP_000290812.1	single-stranded DNA-binding protein	-
NIZ25_RS23805 (47888)	47888..48094	-	207	WP_000547971.1	hypothetical protein	-
NIZ25_RS23810 (48335)	48335..48562	-	228	WP_071594011.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	espL2	1..105541	105541

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T249560 WP_001372321.1 NZ_CP099869:c43487-43362 [Escherichia albertii]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT249560 NZ_CP099869:c43788-43564 [Escherichia albertii]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin