Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 231587..232290 | Replicon | chromosome |
| Accession | NZ_CP099837 | ||
| Organism | Nocardiopsis exhalans strain JCM11759T | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NE857_RS01050 | Protein ID | WP_254419381.1 |
| Coordinates | 231587..231967 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NE857_RS01055 | Protein ID | WP_017579412.1 |
| Coordinates | 231964..232290 (+) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NE857_RS01020 (NE857_01020) | 226967..227467 | + | 501 | WP_039830929.1 | tRNA adenosine deaminase-associated protein | - |
| NE857_RS01025 (NE857_01025) | 227510..227998 | + | 489 | WP_184367081.1 | tRNA adenosine deaminase-associated protein | - |
| NE857_RS01030 (NE857_01030) | 228003..228512 | + | 510 | WP_254419378.1 | nucleoside deaminase | - |
| NE857_RS01040 (NE857_01040) | 228652..229215 | - | 564 | WP_254419379.1 | PadR family transcriptional regulator | - |
| NE857_RS01045 (NE857_01045) | 229280..231295 | - | 2016 | WP_254419380.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| NE857_RS01050 (NE857_01050) | 231587..231967 | + | 381 | WP_254419381.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NE857_RS01055 (NE857_01055) | 231964..232290 | + | 327 | WP_017579412.1 | XRE family transcriptional regulator | Antitoxin |
| NE857_RS01060 (NE857_01060) | 232395..234134 | + | 1740 | WP_254419382.1 | pyruvate dehydrogenase | - |
| NE857_RS01065 (NE857_01065) | 234208..234840 | - | 633 | WP_254419383.1 | maleylpyruvate isomerase family mycothiol-dependent enzyme | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14433.57 Da Isoelectric Point: 5.6646
>T249524 WP_254419381.1 NZ_CP099837:231587-231967 [Nocardiopsis exhalans]
MVVSWNVILLDEVHDWLLVLAKEDPRSADTVVAAIDMLAEVGPILGRPFVDVISHSRIHNLKELRPRTTGDTAIRVLFVF
DPDRQAVLLVAGDKAGRWKQWYDRNIPLAELRYQRWLDGGYTEERG
MVVSWNVILLDEVHDWLLVLAKEDPRSADTVVAAIDMLAEVGPILGRPFVDVISHSRIHNLKELRPRTTGDTAIRVLFVF
DPDRQAVLLVAGDKAGRWKQWYDRNIPLAELRYQRWLDGGYTEERG
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|