Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3914331..3914928 | Replicon | chromosome |
Accession | NZ_CP099834 | ||
Organism | Klebsiella quasipneumoniae strain Y7-3 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NDO72_RS18895 | Protein ID | WP_049013659.1 |
Coordinates | 3914611..3914928 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NDO72_RS18890 | Protein ID | WP_049013658.1 |
Coordinates | 3914331..3914618 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDO72_RS18860 (3910519) | 3910519..3910767 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
NDO72_RS18865 (3910785) | 3910785..3911126 | - | 342 | WP_004202492.1 | RamA family antibiotic efflux transcriptional regulator | - |
NDO72_RS18870 (3911157) | 3911157..3912272 | - | 1116 | WP_074423618.1 | MBL fold metallo-hydrolase | - |
NDO72_RS18875 (3912452) | 3912452..3913036 | + | 585 | WP_023288732.1 | TetR/AcrR family transcriptional regulator | - |
NDO72_RS18880 (3913033) | 3913033..3913401 | + | 369 | WP_048296969.1 | MmcQ/YjbR family DNA-binding protein | - |
NDO72_RS18885 (3913521) | 3913521..3914174 | + | 654 | WP_023288731.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
NDO72_RS18890 (3914331) | 3914331..3914618 | - | 288 | WP_049013658.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NDO72_RS18895 (3914611) | 3914611..3914928 | - | 318 | WP_049013659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NDO72_RS18900 (3915113) | 3915113..3916156 | - | 1044 | WP_032454993.1 | DUF2157 domain-containing protein | - |
NDO72_RS18905 (3916500) | 3916500..3917366 | - | 867 | WP_044521465.1 | helix-turn-helix transcriptional regulator | - |
NDO72_RS18910 (3917475) | 3917475..3918902 | + | 1428 | WP_048334304.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12102.38 Da Isoelectric Point: 11.2767
>T249518 WP_049013659.1 NZ_CP099834:c3914928-3914611 [Klebsiella quasipneumoniae]
MFRMVVHVDVKKELQALPAIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRMVVHVDVKKELQALPAIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|