Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 47031..47696 | Replicon | plasmid pYR4 |
Accession | NZ_CP099806 | ||
Organism | Yersinia ruckeri strain NVI-10705 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A380S9H4 |
Locus tag | LOR96_RS17755 | Protein ID | WP_038251855.1 |
Coordinates | 47031..47354 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | LOR96_RS17760 | Protein ID | WP_004720859.1 |
Coordinates | 47400..47696 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LOR96_RS17715 (LOR96_017710) | 42079..42585 | + | 507 | WP_126940180.1 | antirestriction protein ArdA | - |
LOR96_RS17720 (LOR96_017715) | 42628..42828 | + | 201 | WP_126940179.1 | hypothetical protein | - |
LOR96_RS17725 (LOR96_017720) | 43582..43938 | + | 357 | WP_126940178.1 | hypothetical protein | - |
LOR96_RS17730 (LOR96_017725) | 44024..44170 | + | 147 | WP_126940177.1 | succinate dehydrogenase flavoprotein subunit | - |
LOR96_RS17735 (LOR96_017730) | 44214..45026 | + | 813 | WP_238692894.1 | N-6 DNA methylase | - |
LOR96_RS17740 (LOR96_017735) | 45785..46144 | + | 360 | WP_126940175.1 | DUF3085 domain-containing protein | - |
LOR96_RS17745 (LOR96_017740) | 46141..46638 | + | 498 | WP_126940174.1 | hypothetical protein | - |
LOR96_RS17750 (LOR96_017745) | 46646..46879 | - | 234 | WP_038251853.1 | hypothetical protein | - |
LOR96_RS17755 (LOR96_017750) | 47031..47354 | + | 324 | WP_038251855.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LOR96_RS17760 (LOR96_017755) | 47400..47696 | + | 297 | WP_004720859.1 | NadS family protein | Antitoxin |
LOR96_RS17765 (LOR96_017760) | 48184..48997 | + | 814 | Protein_61 | DUF932 domain-containing protein | - |
LOR96_RS17770 (LOR96_017765) | 49219..49389 | + | 171 | WP_004720852.1 | DUF5983 family protein | - |
LOR96_RS17775 (LOR96_017770) | 49536..49859 | - | 324 | WP_004720850.1 | hypothetical protein | - |
LOR96_RS17780 (LOR96_017775) | 50128..50472 | + | 345 | WP_004720848.1 | plasmid mobilization protein MobA | - |
LOR96_RS17785 (LOR96_017780) | 50474..52399 | + | 1926 | WP_004720847.1 | relaxase/mobilization nuclease domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..115589 | 115589 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12416.31 Da Isoelectric Point: 8.8371
>T249463 WP_038251855.1 NZ_CP099806:47031-47354 [Yersinia ruckeri]
MEYLEFIETPVFSRRRAELLPDDDFRALQEHLLKNHDLGDTISKTGGCKKIRWSREGMGKRGGVRVIYYVITKSGRLYLL
LVYPKNEKDDLTEAEKAVLKSISQQIE
MEYLEFIETPVFSRRRAELLPDDDFRALQEHLLKNHDLGDTISKTGGCKKIRWSREGMGKRGGVRVIYYVITKSGRLYLL
LVYPKNEKDDLTEAEKAVLKSISQQIE
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|