Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5254331..5254926 | Replicon | chromosome |
Accession | NZ_CP099798 | ||
Organism | Pseudomonas aeruginosa strain PAO1-L |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | NHZ68_RS24310 | Protein ID | WP_003113526.1 |
Coordinates | 5254648..5254926 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NHZ68_RS24305 | Protein ID | WP_003113527.1 |
Coordinates | 5254331..5254636 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHZ68_RS24275 (NHZ68_24275) | 5249444..5249734 | - | 291 | WP_033992920.1 | DUF5447 family protein | - |
NHZ68_RS24280 (NHZ68_24280) | 5249946..5250218 | - | 273 | WP_003115921.1 | hypothetical protein | - |
NHZ68_RS24285 (NHZ68_24285) | 5250344..5250613 | + | 270 | WP_071536122.1 | hypothetical protein | - |
NHZ68_RS24290 (NHZ68_24290) | 5250748..5251845 | + | 1098 | WP_169917322.1 | protein phosphatase 2C domain-containing protein | - |
NHZ68_RS24295 (NHZ68_24295) | 5251848..5252897 | + | 1050 | WP_003113529.1 | serine/threonine-protein kinase | - |
NHZ68_RS24300 (NHZ68_24300) | 5252966..5253967 | + | 1002 | WP_228772168.1 | serine/threonine-protein kinase | - |
NHZ68_RS24305 (NHZ68_24305) | 5254331..5254636 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
NHZ68_RS24310 (NHZ68_24310) | 5254648..5254926 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NHZ68_RS24315 (NHZ68_24315) | 5254979..5255107 | - | 129 | Protein_4801 | integrase | - |
NHZ68_RS24320 (NHZ68_24320) | 5255255..5257483 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
NHZ68_RS24325 (NHZ68_24325) | 5257553..5258200 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
NHZ68_RS24330 (NHZ68_24330) | 5258262..5259500 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T249450 WP_003113526.1 NZ_CP099798:c5254926-5254648 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|