Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5195788..5196383 | Replicon | chromosome |
Accession | NZ_CP099797 | ||
Organism | Pseudomonas aeruginosa strain PAO1-N |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | NHZ69_RS24090 | Protein ID | WP_003113526.1 |
Coordinates | 5196105..5196383 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NHZ69_RS24085 | Protein ID | WP_003113527.1 |
Coordinates | 5195788..5196093 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHZ69_RS24055 (NHZ69_24055) | 5190901..5191191 | - | 291 | WP_033992920.1 | DUF5447 family protein | - |
NHZ69_RS24060 (NHZ69_24060) | 5191403..5191675 | - | 273 | WP_003115921.1 | hypothetical protein | - |
NHZ69_RS24065 (NHZ69_24065) | 5191801..5192070 | + | 270 | WP_071536122.1 | hypothetical protein | - |
NHZ69_RS24070 (NHZ69_24070) | 5192205..5193302 | + | 1098 | WP_169917322.1 | protein phosphatase 2C domain-containing protein | - |
NHZ69_RS24075 (NHZ69_24075) | 5193305..5194354 | + | 1050 | WP_003113529.1 | serine/threonine-protein kinase | - |
NHZ69_RS24080 (NHZ69_24080) | 5194423..5195424 | + | 1002 | WP_228772168.1 | serine/threonine-protein kinase | - |
NHZ69_RS24085 (NHZ69_24085) | 5195788..5196093 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
NHZ69_RS24090 (NHZ69_24090) | 5196105..5196383 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NHZ69_RS24095 (NHZ69_24095) | 5196436..5196564 | - | 129 | Protein_4762 | integrase | - |
NHZ69_RS24100 (NHZ69_24100) | 5196712..5198940 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
NHZ69_RS24105 (NHZ69_24105) | 5199010..5199657 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
NHZ69_RS24110 (NHZ69_24110) | 5199719..5200957 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T249443 WP_003113526.1 NZ_CP099797:c5196383-5196105 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|