Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 42099..42745 | Replicon | plasmid p806883-9-2019b |
Accession | NZ_CP099756 | ||
Organism | Escherichia coli strain 806883-9-2019 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NH020_RS26095 | Protein ID | WP_000269912.1 |
Coordinates | 42398..42745 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NH020_RS26090 | Protein ID | WP_001673379.1 |
Coordinates | 42099..42398 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NH020_RS26055 (NH020_26055) | 37269..37517 | + | 249 | WP_000730008.1 | hypothetical protein | - |
NH020_RS26060 (NH020_26060) | 37580..37729 | + | 150 | WP_173672731.1 | hypothetical protein | - |
NH020_RS26065 (NH020_26065) | 38822..39013 | + | 192 | WP_000183351.1 | hypothetical protein | - |
NH020_RS26070 (NH020_26070) | 39010..40191 | + | 1182 | WP_171874464.1 | ORF6N domain-containing protein | - |
NH020_RS26075 (NH020_26075) | 40798..41070 | - | 273 | WP_089591621.1 | helix-turn-helix domain-containing protein | - |
NH020_RS26080 (NH020_26080) | 41134..41514 | - | 381 | WP_000061763.1 | hypothetical protein | - |
NH020_RS26085 (NH020_26085) | 41781..42065 | + | 285 | WP_001673380.1 | hypothetical protein | - |
NH020_RS26090 (NH020_26090) | 42099..42398 | - | 300 | WP_001673379.1 | XRE family transcriptional regulator | Antitoxin |
NH020_RS26095 (NH020_26095) | 42398..42745 | - | 348 | WP_000269912.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NH020_RS26100 (NH020_26100) | 42990..43253 | - | 264 | WP_000424604.1 | hypothetical protein | - |
NH020_RS26105 (NH020_26105) | 43277..43564 | - | 288 | WP_000356589.1 | hypothetical protein | - |
NH020_RS26110 (NH020_26110) | 44208..45185 | - | 978 | WP_001704997.1 | plasmid replication initiator RepA | - |
NH020_RS26115 (NH020_26115) | 45397..45489 | + | 93 | Protein_63 | hypothetical protein | - |
NH020_RS26120 (NH020_26120) | 45652..46215 | + | 564 | WP_001523082.1 | serine acetyltransferase | - |
NH020_RS26125 (NH020_26125) | 46179..46796 | - | 618 | WP_001523080.1 | tail fiber assembly protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..47500 | 47500 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13545.51 Da Isoelectric Point: 8.8337
>T249436 WP_000269912.1 NZ_CP099756:c42745-42398 [Escherichia coli]
MWTVLFSQRFDDWLNEQEDALQEKVLADLKKLQVYGPELPRPYADTVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAI
VLCAGDKSNDKRFYEKLVRIAEDEFAAHLNTLESK
MWTVLFSQRFDDWLNEQEDALQEKVLADLKKLQVYGPELPRPYADTVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAI
VLCAGDKSNDKRFYEKLVRIAEDEFAAHLNTLESK
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|