Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 13599..14256 | Replicon | plasmid pJEF1-OXA-181 |
Accession | NZ_CP099755 | ||
Organism | Escherichia coli strain 806883-9-2019 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U3PDC3 |
Locus tag | NH020_RS24930 | Protein ID | WP_000270043.1 |
Coordinates | 13906..14256 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NH020_RS24925 | Protein ID | WP_000124640.1 |
Coordinates | 13599..13901 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NH020_RS24875 (NH020_24875) | 9233..9661 | + | 429 | WP_000591076.1 | hypothetical protein | - |
NH020_RS24880 (NH020_24880) | 9719..10078 | + | 360 | WP_000422769.1 | hypothetical protein | - |
NH020_RS24885 (NH020_24885) | 10078..10524 | + | 447 | WP_000919343.1 | hypothetical protein | - |
NH020_RS24890 (NH020_24890) | 10521..11039 | + | 519 | WP_000210757.1 | nitrite reductase | - |
NH020_RS24895 (NH020_24895) | 11039..11269 | + | 231 | WP_000972665.1 | hypothetical protein | - |
NH020_RS24900 (NH020_24900) | 11256..12113 | + | 858 | WP_001167036.1 | hypothetical protein | - |
NH020_RS24905 (NH020_24905) | 12139..12330 | + | 192 | WP_001270409.1 | hypothetical protein | - |
NH020_RS24910 (NH020_24910) | 12333..12860 | + | 528 | WP_004201083.1 | thermonuclease family protein | - |
NH020_RS24915 (NH020_24915) | 12918..13190 | + | 273 | WP_001043046.1 | HU family DNA-binding protein | - |
NH020_RS24920 (NH020_24920) | 13279..13572 | + | 294 | WP_001239998.1 | hypothetical protein | - |
NH020_RS24925 (NH020_24925) | 13599..13901 | - | 303 | WP_000124640.1 | XRE family transcriptional regulator | Antitoxin |
NH020_RS24930 (NH020_24930) | 13906..14256 | - | 351 | WP_000270043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NH020_RS24935 (NH020_24935) | 14419..14967 | + | 549 | WP_001061573.1 | hypothetical protein | - |
NH020_RS24940 (NH020_24940) | 15308..15502 | + | 195 | WP_000343597.1 | hypothetical protein | - |
NH020_RS24945 (NH020_24945) | 15513..15884 | + | 372 | WP_000516918.1 | hypothetical protein | - |
NH020_RS24950 (NH020_24950) | 15877..16347 | + | 471 | WP_001281821.1 | hypothetical protein | - |
NH020_RS24955 (NH020_24955) | 16362..16697 | - | 336 | WP_000683477.1 | hypothetical protein | - |
NH020_RS24960 (NH020_24960) | 16794..17282 | + | 489 | WP_001273096.1 | DUF1643 domain-containing protein | - |
NH020_RS24965 (NH020_24965) | 17285..17782 | + | 498 | WP_000062185.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaOXA-181 / blaCMY-4 / dfrA12 / aadA2 / qacE / sul1 / armA / msr(E) / mph(E) | - | 1..177860 | 177860 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13328.21 Da Isoelectric Point: 5.2421
>T249435 WP_000270043.1 NZ_CP099755:c14256-13906 [Escherichia coli]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|