Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4918833..4919435 | Replicon | chromosome |
Accession | NZ_CP099754 | ||
Organism | Escherichia coli strain 806883-9-2019 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | NH020_RS23755 | Protein ID | WP_000897305.1 |
Coordinates | 4919124..4919435 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NH020_RS23750 | Protein ID | WP_000356397.1 |
Coordinates | 4918833..4919123 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NH020_RS23730 (4915335) | 4915335..4916237 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
NH020_RS23735 (4916234) | 4916234..4916869 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
NH020_RS23740 (4916866) | 4916866..4917795 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
NH020_RS23745 (4918010) | 4918010..4918228 | - | 219 | WP_001298592.1 | CopG family transcriptional regulator | - |
NH020_RS23750 (4918833) | 4918833..4919123 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
NH020_RS23755 (4919124) | 4919124..4919435 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
NH020_RS23760 (4919664) | 4919664..4920572 | + | 909 | WP_001318161.1 | alpha/beta hydrolase | - |
NH020_RS23765 (4920636) | 4920636..4921577 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NH020_RS23770 (4921622) | 4921622..4922059 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
NH020_RS23775 (4922056) | 4922056..4922928 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
NH020_RS23780 (4922922) | 4922922..4923521 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
NH020_RS23785 (4923620) | 4923620..4924405 | - | 786 | WP_000059679.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T249434 WP_000897305.1 NZ_CP099754:c4919435-4919124 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|