Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4026191..4026885 | Replicon | chromosome |
Accession | NZ_CP099754 | ||
Organism | Escherichia coli strain 806883-9-2019 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q0T7Q5 |
Locus tag | NH020_RS19410 | Protein ID | WP_001263491.1 |
Coordinates | 4026191..4026589 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | L4JHF0 |
Locus tag | NH020_RS19415 | Protein ID | WP_000554755.1 |
Coordinates | 4026592..4026885 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NH020_RS19380 (4021453) | 4021453..4022910 | + | 1458 | WP_022645227.1 | cytosol nonspecific dipeptidase | - |
NH020_RS19385 (4022919) | 4022919..4023200 | + | 282 | WP_022645226.1 | hypothetical protein | - |
NH020_RS19390 (4023217) | 4023217..4023726 | - | 510 | WP_001361775.1 | metal-dependent hydrolase | - |
NH020_RS19395 (4023788) | 4023788..4024402 | - | 615 | WP_022645225.1 | peptide chain release factor H | - |
NH020_RS19400 (4024399) | 4024399..4025538 | - | 1140 | WP_022645224.1 | RNA ligase RtcB family protein | - |
NH020_RS19405 (4025729) | 4025729..4026181 | - | 453 | WP_023909048.1 | GNAT family N-acetyltransferase | - |
NH020_RS19410 (4026191) | 4026191..4026589 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
NH020_RS19415 (4026592) | 4026592..4026885 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
NH020_RS19420 (4026937) | 4026937..4027992 | - | 1056 | WP_022645222.1 | DNA polymerase IV | - |
NH020_RS19425 (4028063) | 4028063..4028848 | - | 786 | WP_072224360.1 | putative lateral flagellar export/assembly protein LafU | - |
NH020_RS19430 (4028820) | 4028820..4030532 | + | 1713 | Protein_3812 | flagellar biosynthesis protein FlhA | - |
NH020_RS19435 (4030630) | 4030630..4031403 | - | 774 | WP_022645219.1 | C40 family peptidase | - |
NH020_RS19440 (4031589) | 4031589..4031849 | + | 261 | WP_000729708.1 | type II toxin-antitoxin system antitoxin DinJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T249427 WP_001263491.1 NZ_CP099754:c4026589-4026191 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G9H5 |