Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-HTH
Location 54835..55509 Replicon plasmid p806883-10-2019a
Accession NZ_CP099749
Organism Klebsiella pneumoniae strain 806883-10-2019

Toxin (Protein)


Gene name higB Uniprot ID A0A5Q9LMS5
Locus tag NHF42_RS26130 Protein ID WP_032720638.1
Coordinates 55186..55509 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NHF42_RS26125 Protein ID WP_032720637.1
Coordinates 54835..55137 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NHF42_RS26085 (NHF42_26070) 50028..50600 + 573 WP_044266753.1 hypothetical protein -
NHF42_RS26090 (NHF42_26075) 50631..51125 + 495 WP_044266755.1 hypothetical protein -
NHF42_RS26095 (NHF42_26080) 51428..52348 + 921 WP_050548604.1 TauD/TfdA family dioxygenase -
NHF42_RS26100 (NHF42_26085) 52360..53172 + 813 WP_223203129.1 TSUP family transporter -
NHF42_RS26105 (NHF42_26090) 53174..53746 + 573 WP_032720635.1 GNAT family N-acetyltransferase -
NHF42_RS26110 (NHF42_26095) 53851..54234 + 384 WP_032720636.1 hypothetical protein -
NHF42_RS26115 (NHF42_26100) 54231..54437 + 207 WP_153591439.1 hypothetical protein -
NHF42_RS26120 (NHF42_26105) 54625..54792 + 168 WP_153591440.1 hypothetical protein -
NHF42_RS26125 (NHF42_26110) 54835..55137 - 303 WP_032720637.1 NadS family protein Antitoxin
NHF42_RS26130 (NHF42_26115) 55186..55509 - 324 WP_032720638.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NHF42_RS26135 (NHF42_26120) 55687..56092 - 406 Protein_59 DUF4113 domain-containing protein -
NHF42_RS26140 (NHF42_26125) 56070..56497 + 428 Protein_60 DNA-binding protein -
NHF42_RS26145 (NHF42_26130) 56566..57168 - 603 Protein_61 transposase -
NHF42_RS26150 (NHF42_26135) 57869..58819 + 951 WP_004181945.1 CBASS oligonucleotide cyclase -
NHF42_RS26155 (NHF42_26140) 58816..59307 + 492 WP_004181946.1 hypothetical protein -
NHF42_RS26160 (NHF42_26145) 59307..60206 + 900 WP_032455430.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..243395 243395
- flank IS/Tn - - 56566..56964 398


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(45-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(39-83)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12372.29 Da        Isoelectric Point: 9.6240

>T249391 WP_032720638.1 NZ_CP099749:c55509-55186 [Klebsiella pneumoniae]
MNYLEFVETSAFSGLRKELMDDDEFRELQTYLLEAHDRGDTISHTGGCRKIRWGRPGMGKRGGVRVIYYVRLASGRLYLL
LIYPKNAKDELSEKEKAVMKALTQQLK

Download         Length: 324 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11211.12 Da        Isoelectric Point: 7.3611

>AT249391 WP_032720637.1 NZ_CP099749:c55137-54835 [Klebsiella pneumoniae]
MEKKLFDALISSMEEMVAIENGQIQPAAEQVHRHTLPDVKAIRKHAGMKQAEFAEVVGASVDLVRSWEQQRRVPSGIALK
MLCLIEREPALINTLRGIHV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q9LMS5

Antitoxin

Source ID Structure

References