Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3935064..3935661 | Replicon | chromosome |
Accession | NZ_CP099748 | ||
Organism | Klebsiella pneumoniae strain 806883-10-2019 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A9J6S5A1 |
Locus tag | NHF42_RS19115 | Protein ID | WP_004893639.1 |
Coordinates | 3935344..3935661 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | NHF42_RS19110 | Protein ID | WP_004142561.1 |
Coordinates | 3935064..3935351 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHF42_RS19080 (NHF42_19070) | 3931144..3931392 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
NHF42_RS19085 (NHF42_19075) | 3931410..3931751 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
NHF42_RS19090 (NHF42_19080) | 3931782..3932897 | - | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
NHF42_RS19095 (NHF42_19085) | 3933077..3933658 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
NHF42_RS19100 (NHF42_19090) | 3933658..3934026 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
NHF42_RS19105 (NHF42_19095) | 3934146..3934799 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
NHF42_RS19110 (NHF42_19100) | 3935064..3935351 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NHF42_RS19115 (NHF42_19105) | 3935344..3935661 | - | 318 | WP_004893639.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NHF42_RS19120 (NHF42_19110) | 3935846..3936889 | - | 1044 | WP_004893645.1 | DUF2157 domain-containing protein | - |
NHF42_RS19125 (NHF42_19115) | 3937555..3938421 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
NHF42_RS19130 (NHF42_19120) | 3938530..3939957 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12100.35 Da Isoelectric Point: 11.2767
>T249384 WP_004893639.1 NZ_CP099748:c3935661-3935344 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|