Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 351740..352326 Replicon chromosome
Accession NZ_CP099748
Organism Klebsiella pneumoniae strain 806883-10-2019

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NHF42_RS01615 Protein ID WP_002920800.1
Coordinates 351958..352326 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NHF42_RS01610 Protein ID WP_004174006.1
Coordinates 351740..351961 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NHF42_RS01590 (NHF42_01590) 347897..348823 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NHF42_RS01595 (NHF42_01595) 348820..350097 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NHF42_RS01600 (NHF42_01600) 350094..350861 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NHF42_RS01605 (NHF42_01605) 350863..351576 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NHF42_RS01610 (NHF42_01610) 351740..351961 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NHF42_RS01615 (NHF42_01615) 351958..352326 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NHF42_RS01620 (NHF42_01620) 352599..353915 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NHF42_RS01625 (NHF42_01625) 354022..354909 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NHF42_RS01630 (NHF42_01630) 354906..355751 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NHF42_RS01635 (NHF42_01635) 355753..356823 + 1071 WP_004889423.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 348820..357560 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T249376 WP_002920800.1 NZ_CP099748:351958-352326 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT249376 WP_004174006.1 NZ_CP099748:351740-351961 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References