Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-HTH
Location 54835..55509 Replicon plasmid p503666-2-2019a
Accession NZ_CP099744
Organism Klebsiella pneumoniae strain 503666-2-2019

Toxin (Protein)


Gene name higB Uniprot ID A0A5Q9LMS5
Locus tag NHF44_RS25960 Protein ID WP_032720638.1
Coordinates 55186..55509 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NHF44_RS25955 Protein ID WP_032720637.1
Coordinates 54835..55137 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NHF44_RS25915 (NHF44_25900) 50028..50600 + 573 WP_044266753.1 hypothetical protein -
NHF44_RS25920 (NHF44_25905) 50631..51125 + 495 WP_044266755.1 hypothetical protein -
NHF44_RS25925 (NHF44_25910) 51428..52348 + 921 WP_050548604.1 TauD/TfdA family dioxygenase -
NHF44_RS25930 (NHF44_25915) 52360..53172 + 813 WP_223203129.1 TSUP family transporter -
NHF44_RS25935 (NHF44_25920) 53174..53746 + 573 WP_032720635.1 GNAT family N-acetyltransferase -
NHF44_RS25940 (NHF44_25925) 53851..54234 + 384 WP_032720636.1 hypothetical protein -
NHF44_RS25945 (NHF44_25930) 54231..54437 + 207 WP_153591439.1 hypothetical protein -
NHF44_RS25950 (NHF44_25935) 54625..54792 + 168 WP_153591440.1 hypothetical protein -
NHF44_RS25955 (NHF44_25940) 54835..55137 - 303 WP_032720637.1 NadS family protein Antitoxin
NHF44_RS25960 (NHF44_25945) 55186..55509 - 324 WP_032720638.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NHF44_RS25965 (NHF44_25950) 55687..56092 - 406 Protein_59 DUF4113 domain-containing protein -
NHF44_RS25970 (NHF44_25955) 56070..56497 + 428 Protein_60 DNA-binding protein -
NHF44_RS25975 (NHF44_25960) 56566..57168 - 603 Protein_61 transposase -
NHF44_RS25980 (NHF44_25965) 57869..58819 + 951 WP_004181945.1 CBASS oligonucleotide cyclase -
NHF44_RS25985 (NHF44_25970) 58816..59307 + 492 WP_004181946.1 hypothetical protein -
NHF44_RS25990 (NHF44_25975) 59307..60206 + 900 WP_032455430.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..243656 243656
- flank IS/Tn - - 56566..56964 398


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(45-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(39-83)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12372.29 Da        Isoelectric Point: 9.6240

>T249372 WP_032720638.1 NZ_CP099744:c55509-55186 [Klebsiella pneumoniae]
MNYLEFVETSAFSGLRKELMDDDEFRELQTYLLEAHDRGDTISHTGGCRKIRWGRPGMGKRGGVRVIYYVRLASGRLYLL
LIYPKNAKDELSEKEKAVMKALTQQLK

Download         Length: 324 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11211.12 Da        Isoelectric Point: 7.3611

>AT249372 WP_032720637.1 NZ_CP099744:c55137-54835 [Klebsiella pneumoniae]
MEKKLFDALISSMEEMVAIENGQIQPAAEQVHRHTLPDVKAIRKHAGMKQAEFAEVVGASVDLVRSWEQQRRVPSGIALK
MLCLIEREPALINTLRGIHV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q9LMS5

Antitoxin

Source ID Structure

References