Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 115966..116220 | Replicon | plasmid pGDE043-2 |
| Accession | NZ_CP099723 | ||
| Organism | Escherichia coli strain EC21GDE043 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NH569_RS26145 | Protein ID | WP_001312851.1 |
| Coordinates | 115966..116115 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 116159..116220 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NH569_RS26100 (111519) | 111519..111920 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NH569_RS26105 (111853) | 111853..112110 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NH569_RS26110 (112203) | 112203..112856 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| NH569_RS26115 (112954) | 112954..113094 | - | 141 | WP_001333237.1 | hypothetical protein | - |
| NH569_RS26120 (113794) | 113794..114651 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| NH569_RS26125 (114644) | 114644..115126 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| NH569_RS26130 (115119) | 115119..115166 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| NH569_RS26135 (115157) | 115157..115408 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| NH569_RS26140 (115425) | 115425..115682 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| NH569_RS26145 (115966) | 115966..116115 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (116159) | 116159..116220 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (116159) | 116159..116220 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (116159) | 116159..116220 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (116159) | 116159..116220 | + | 62 | NuclAT_1 | - | Antitoxin |
| NH569_RS26150 (116476) | 116476..116550 | - | 75 | Protein_123 | endonuclease | - |
| NH569_RS26155 (116796) | 116796..117008 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| NH569_RS26160 (117144) | 117144..117704 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| NH569_RS26165 (117807) | 117807..118667 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| NH569_RS26170 (118726) | 118726..119472 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | qnrS1 / blaLAP-2 / dfrA14 / ant(3'')-Ia / blaOXA-10 / cmlA1 / ARR-3 / sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..203860 | 203860 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T249339 WP_001312851.1 NZ_CP099723:c116115-115966 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT249339 NZ_CP099723:116159-116220 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
