Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4706932..4707534 | Replicon | chromosome |
| Accession | NZ_CP099721 | ||
| Organism | Escherichia coli strain EC21GDE043 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | NH569_RS23070 | Protein ID | WP_000897302.1 |
| Coordinates | 4707223..4707534 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NH569_RS23065 | Protein ID | WP_000356397.1 |
| Coordinates | 4706932..4707222 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NH569_RS23040 (4703005) | 4703005..4703907 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| NH569_RS23045 (4703904) | 4703904..4704539 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NH569_RS23050 (4704536) | 4704536..4705465 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| NH569_RS23055 (4705681) | 4705681..4705899 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
| NH569_RS23060 (4706295) | 4706295..4706573 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| NH569_RS23065 (4706932) | 4706932..4707222 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| NH569_RS23070 (4707223) | 4707223..4707534 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| NH569_RS23075 (4707763) | 4707763..4708671 | + | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
| NH569_RS23080 (4708735) | 4708735..4709676 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| NH569_RS23085 (4709721) | 4709721..4710158 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| NH569_RS23090 (4710155) | 4710155..4711027 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| NH569_RS23095 (4711021) | 4711021..4711620 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T249337 WP_000897302.1 NZ_CP099721:c4707534-4707223 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|