Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-rdlD/SymE(toxin) |
Location | 4123394..4123806 | Replicon | chromosome |
Accession | NZ_CP099721 | ||
Organism | Escherichia coli strain EC21GDE043 |
Toxin (Protein)
Gene name | symE | Uniprot ID | A0A8E0IWC4 |
Locus tag | NH569_RS20235 | Protein ID | WP_001513534.1 |
Coordinates | 4123465..4123806 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 4123394..4123470 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NH569_RS20225 (4120006) | 4120006..4121475 | + | 1470 | WP_001387312.1 | type I restriction-modification system subunit M | - |
NH569_RS20230 (4121475) | 4121475..4123244 | + | 1770 | WP_001513535.1 | restriction endonuclease subunit S | - |
- (4123394) | 4123394..4123470 | - | 77 | NuclAT_6 | - | Antitoxin |
- (4123394) | 4123394..4123470 | - | 77 | NuclAT_6 | - | Antitoxin |
- (4123394) | 4123394..4123470 | - | 77 | NuclAT_6 | - | Antitoxin |
- (4123394) | 4123394..4123470 | - | 77 | NuclAT_6 | - | Antitoxin |
- (4123394) | 4123394..4123470 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4123394) | 4123394..4123470 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4123394) | 4123394..4123470 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4123394) | 4123394..4123470 | - | 77 | NuclAT_7 | - | Antitoxin |
NH569_RS20235 (4123465) | 4123465..4123806 | + | 342 | WP_001513534.1 | endoribonuclease SymE | Toxin |
NH569_RS20240 (4123853) | 4123853..4125016 | - | 1164 | WP_224153787.1 | DUF1524 domain-containing protein | - |
NH569_RS20245 (4125070) | 4125070..4125946 | - | 877 | Protein_3961 | DUF262 domain-containing protein | - |
NH569_RS20250 (4126352) | 4126352..4127272 | - | 921 | WP_001513532.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
NH569_RS20255 (4127457) | 4127457..4128737 | + | 1281 | WP_001338077.1 | DUF445 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | cheD | 4107782..4123806 | 16024 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12247.03 Da Isoelectric Point: 7.8545
>T249331 WP_001513534.1 NZ_CP099721:4123465-4123806 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASHYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASHYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT249331 NZ_CP099721:c4123470-4123394 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|