Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3710852..3711546 | Replicon | chromosome |
| Accession | NZ_CP099721 | ||
| Organism | Escherichia coli strain EC21GDE043 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | NH569_RS18160 | Protein ID | WP_001263500.1 |
| Coordinates | 3710852..3711250 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | NH569_RS18165 | Protein ID | WP_000554758.1 |
| Coordinates | 3711253..3711546 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NH569_RS18135 (3706217) | 3706217..3706675 | - | 459 | WP_001291988.1 | xanthine phosphoribosyltransferase | - |
| NH569_RS18140 (3706936) | 3706936..3708393 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
| NH569_RS18145 (3708450) | 3708450..3709064 | - | 615 | WP_000602123.1 | peptide chain release factor H | - |
| NH569_RS18150 (3709061) | 3709061..3710200 | - | 1140 | WP_000521577.1 | RNA ligase RtcB family protein | - |
| NH569_RS18155 (3710390) | 3710390..3710842 | - | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
| NH569_RS18160 (3710852) | 3710852..3711250 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| NH569_RS18165 (3711253) | 3711253..3711546 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| NH569_RS18170 (3711598) | 3711598..3712653 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
| NH569_RS18175 (3712724) | 3712724..3713509 | - | 786 | WP_000207544.1 | putative lateral flagellar export/assembly protein LafU | - |
| NH569_RS18180 (3713481) | 3713481..3715193 | + | 1713 | Protein_3558 | flagellar biosynthesis protein FlhA | - |
| NH569_RS18185 (3715272) | 3715272..3715430 | + | 159 | WP_014639450.1 | hypothetical protein | - |
| NH569_RS18190 (3715513) | 3715513..3716010 | - | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | gmhA/lpcA | 3710852..3731205 | 20353 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T249329 WP_001263500.1 NZ_CP099721:c3711250-3710852 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|