Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3492294..3492973 | Replicon | chromosome |
Accession | NZ_CP099721 | ||
Organism | Escherichia coli strain EC21GDE043 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V0VBP6 |
Locus tag | NH569_RS17115 | Protein ID | WP_000057524.1 |
Coordinates | 3492671..3492973 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | NH569_RS17110 | Protein ID | WP_000806442.1 |
Coordinates | 3492294..3492635 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NH569_RS17100 (3488538) | 3488538..3489470 | - | 933 | WP_000883052.1 | glutaminase A | - |
NH569_RS17105 (3489732) | 3489732..3492236 | + | 2505 | WP_000083945.1 | copper-exporting P-type ATPase CopA | - |
NH569_RS17110 (3492294) | 3492294..3492635 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
NH569_RS17115 (3492671) | 3492671..3492973 | - | 303 | WP_000057524.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NH569_RS17120 (3493106) | 3493106..3493900 | + | 795 | WP_000365177.1 | TraB/GumN family protein | - |
NH569_RS17125 (3494104) | 3494104..3494583 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
NH569_RS17130 (3494607) | 3494607..3495185 | + | 579 | WP_021522671.1 | hypothetical protein | - |
NH569_RS17135 (3495404) | 3495404..3495907 | + | 504 | WP_000667000.1 | hypothetical protein | - |
NH569_RS17140 (3495945) | 3495945..3497597 | - | 1653 | WP_001513633.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3484983..3495907 | 10924 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11839.47 Da Isoelectric Point: 10.2237
>T249327 WP_000057524.1 NZ_CP099721:c3492973-3492671 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|