Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 178478..178700 Replicon chromosome
Accession NZ_CP099721
Organism Escherichia coli strain EC21GDE043

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag NH569_RS00840 Protein ID WP_001295224.1
Coordinates 178593..178700 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 178478..178536 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NH569_RS00815 173867..174850 + 984 WP_001196477.1 dipeptide ABC transporter ATP-binding protein -
NH569_RS00820 174847..175851 + 1005 WP_000103579.1 dipeptide ABC transporter ATP-binding subunit DppF -
NH569_RS00825 175881..177152 - 1272 WP_001332306.1 aromatic amino acid transport family protein -
NH569_RS00830 177628..177735 + 108 WP_000170745.1 type I toxin-antitoxin system toxin Ldr family protein -
NH569_RS00835 178110..178217 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- 178478..178536 - 59 - - Antitoxin
NH569_RS00840 178593..178700 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
NH569_RS00845 178786..180465 - 1680 WP_000191567.1 cellulose biosynthesis protein BcsG -
NH569_RS00850 180462..180653 - 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
NH569_RS00855 180650..182221 - 1572 WP_001204957.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
NH569_RS00860 182494..182682 + 189 WP_001063314.1 cellulose biosynthesis protein BcsR -
NH569_RS00865 182694..183446 + 753 WP_000279545.1 cellulose biosynthesis protein BcsQ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T249314 WP_001295224.1 NZ_CP099721:178593-178700 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

Antitoxin


Download         Length: 59 bp

>AT249314 NZ_CP099721:c178536-178478 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References