Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2445203..2445725 | Replicon | chromosome |
Accession | NZ_CP099705 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain 013+ |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | NG892_RS12020 | Protein ID | WP_000221343.1 |
Coordinates | 2445441..2445725 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NG892_RS12015 | Protein ID | WP_000885424.1 |
Coordinates | 2445203..2445451 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG892_RS11990 (2440419) | 2440419..2441885 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
NG892_RS11995 (2442693) | 2442693..2443407 | + | 715 | Protein_2344 | helix-turn-helix domain-containing protein | - |
NG892_RS12000 (2443463) | 2443463..2444371 | - | 909 | WP_010989018.1 | hypothetical protein | - |
NG892_RS12005 (2444514) | 2444514..2444846 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
NG892_RS12010 (2444836) | 2444836..2445051 | - | 216 | WP_000206207.1 | hypothetical protein | - |
NG892_RS12015 (2445203) | 2445203..2445451 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NG892_RS12020 (2445441) | 2445441..2445725 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NG892_RS12025 (2445896) | 2445896..2446285 | + | 390 | WP_000194089.1 | RidA family protein | - |
NG892_RS12030 (2446337) | 2446337..2447416 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NG892_RS12035 (2447609) | 2447609..2448097 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NG892_RS12040 (2448142) | 2448142..2449650 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2440422..2452507 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T249298 WP_000221343.1 NZ_CP099705:2445441-2445725 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |