Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 2271487..2272187 | Replicon | chromosome |
Accession | NZ_CP099645 | ||
Organism | Paraburkholderia fungorum strain OTU2SAUBB1 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | A0A2T1AWY4 |
Locus tag | NHH62_RS12335 | Protein ID | WP_030100731.1 |
Coordinates | 2271891..2272187 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | - |
Locus tag | NHH62_RS12330 | Protein ID | WP_028197207.1 |
Coordinates | 2271487..2271888 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHH62_RS12320 (NHH62_12325) | 2266931..2270413 | - | 3483 | WP_253044792.1 | DEAD/DEAH box helicase | - |
NHH62_RS12325 (NHH62_12330) | 2270603..2271382 | - | 780 | WP_028197206.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
NHH62_RS12330 (NHH62_12335) | 2271487..2271888 | - | 402 | WP_028197207.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
NHH62_RS12335 (NHH62_12340) | 2271891..2272187 | - | 297 | WP_030100731.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
NHH62_RS12340 (NHH62_12345) | 2272355..2274859 | + | 2505 | WP_030100732.1 | FAD-dependent oxidoreductase | - |
NHH62_RS12345 (NHH62_12350) | 2274826..2275395 | - | 570 | WP_030100733.1 | cytochrome b | - |
NHH62_RS12350 (NHH62_12355) | 2275392..2276483 | - | 1092 | WP_030100734.1 | catalase family peroxidase | - |
NHH62_RS12355 (NHH62_12360) | 2276591..2276860 | - | 270 | WP_028197212.1 | DUF4148 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10739.53 Da Isoelectric Point: 7.8545
>T249282 WP_030100731.1 NZ_CP099645:c2272187-2271891 [Paraburkholderia fungorum]
MEKSTPHCKLAEVQSLARAGNIRITKSAVIGAAALGLGPAAIIETLLSLERGNFRKSMTTYADHRVWQDVYCAVTEAGMV
YLKLTVIDDVLVVSFKEW
MEKSTPHCKLAEVQSLARAGNIRITKSAVIGAAALGLGPAAIIETLLSLERGNFRKSMTTYADHRVWQDVYCAVTEAGMV
YLKLTVIDDVLVVSFKEW
Download Length: 297 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14738.86 Da Isoelectric Point: 5.0016
>AT249282 WP_028197207.1 NZ_CP099645:c2271888-2271487 [Paraburkholderia fungorum]
MKCPNCGAAELVRDTRNMRYVYKGETAVFEAVTGDYCPACDEAVLDIDEATRTGQMMLAFNKEVNASQVDPAFIAAVRKK
LDLDQREAAEIFGGGVNAFSRYENGKTRPPLALIKLLKVLDRHPELLEEVRAS
MKCPNCGAAELVRDTRNMRYVYKGETAVFEAVTGDYCPACDEAVLDIDEATRTGQMMLAFNKEVNASQVDPAFIAAVRKK
LDLDQREAAEIFGGGVNAFSRYENGKTRPPLALIKLLKVLDRHPELLEEVRAS
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|