Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 25057..25757 | Replicon | chromosome |
| Accession | NZ_CP099629 | ||
| Organism | Paraburkholderia fungorum strain OTU2BAGNBA2 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | A0A2T1AWY4 |
| Locus tag | NFS19_RS22945 | Protein ID | WP_030100731.1 |
| Coordinates | 25461..25757 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | - |
| Locus tag | NFS19_RS22940 | Protein ID | WP_028197207.1 |
| Coordinates | 25057..25458 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFS19_RS22930 (NFS19_22920) | 20500..23982 | - | 3483 | WP_252890150.1 | DEAD/DEAH box helicase | - |
| NFS19_RS22935 (NFS19_22925) | 24172..24951 | - | 780 | WP_028197206.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NFS19_RS22940 (NFS19_22930) | 25057..25458 | - | 402 | WP_028197207.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| NFS19_RS22945 (NFS19_22935) | 25461..25757 | - | 297 | WP_030100731.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
| NFS19_RS22950 (NFS19_22940) | 25925..28429 | + | 2505 | WP_046570655.1 | FAD-dependent oxidoreductase | - |
| NFS19_RS22955 (NFS19_22945) | 28426..28965 | - | 540 | WP_046570668.1 | cytochrome b | - |
| NFS19_RS22960 (NFS19_22950) | 28962..30053 | - | 1092 | WP_252890149.1 | catalase family peroxidase | - |
| NFS19_RS22965 (NFS19_22955) | 30161..30430 | - | 270 | WP_028197212.1 | DUF4148 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10739.53 Da Isoelectric Point: 7.8545
>T249277 WP_030100731.1 NZ_CP099629:c25757-25461 [Paraburkholderia fungorum]
MEKSTPHCKLAEVQSLARAGNIRITKSAVIGAAALGLGPAAIIETLLSLERGNFRKSMTTYADHRVWQDVYCAVTEAGMV
YLKLTVIDDVLVVSFKEW
MEKSTPHCKLAEVQSLARAGNIRITKSAVIGAAALGLGPAAIIETLLSLERGNFRKSMTTYADHRVWQDVYCAVTEAGMV
YLKLTVIDDVLVVSFKEW
Download Length: 297 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14738.86 Da Isoelectric Point: 5.0016
>AT249277 WP_028197207.1 NZ_CP099629:c25458-25057 [Paraburkholderia fungorum]
MKCPNCGAAELVRDTRNMRYVYKGETAVFEAVTGDYCPACDEAVLDIDEATRTGQMMLAFNKEVNASQVDPAFIAAVRKK
LDLDQREAAEIFGGGVNAFSRYENGKTRPPLALIKLLKVLDRHPELLEEVRAS
MKCPNCGAAELVRDTRNMRYVYKGETAVFEAVTGDYCPACDEAVLDIDEATRTGQMMLAFNKEVNASQVDPAFIAAVRKK
LDLDQREAAEIFGGGVNAFSRYENGKTRPPLALIKLLKVLDRHPELLEEVRAS
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|