Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3941305..3942058 | Replicon | chromosome |
Accession | NZ_CP099623 | ||
Organism | Paraburkholderia fungorum strain OTU2BAGNBA1 |
Toxin (Protein)
Gene name | graT | Uniprot ID | A0A0D5V7W6 |
Locus tag | NFE55_RS17480 | Protein ID | WP_028200139.1 |
Coordinates | 3941305..3941586 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NFE55_RS17485 | Protein ID | WP_046568014.1 |
Coordinates | 3941603..3942058 (+) | Length | 152 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFE55_RS17470 (NFE55_17470) | 3937455..3938162 | - | 708 | WP_028200136.1 | DUF4136 domain-containing protein | - |
NFE55_RS17475 (NFE55_17475) | 3938386..3941082 | + | 2697 | WP_252888335.1 | aminopeptidase N | - |
NFE55_RS17480 (NFE55_17480) | 3941305..3941586 | + | 282 | WP_028200139.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFE55_RS17485 (NFE55_17485) | 3941603..3942058 | + | 456 | WP_046568014.1 | HigA family addiction module antitoxin | Antitoxin |
NFE55_RS17490 (NFE55_17490) | 3942180..3943196 | + | 1017 | WP_028200141.1 | class 1 fructose-bisphosphatase | - |
NFE55_RS17500 (NFE55_17500) | 3943448..3944824 | + | 1377 | WP_252888336.1 | tyrosine-type recombinase/integrase | - |
NFE55_RS17505 (NFE55_17505) | 3944821..3945771 | - | 951 | WP_252888337.1 | ParB N-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10547.19 Da Isoelectric Point: 9.0944
>T249269 WP_028200139.1 NZ_CP099623:3941305-3941586 [Paraburkholderia fungorum]
MITTFGDKATAAIFHGKFVHSLPLYMQALARRKLLMIDAAESIRSLHAPPGNRLEALQGQRSGQWSIRINAQWRICFHFV
DGEALNVEIVDYH
MITTFGDKATAAIFHGKFVHSLPLYMQALARRKLLMIDAAESIRSLHAPPGNRLEALQGQRSGQWSIRINAQWRICFHFV
DGEALNVEIVDYH
Download Length: 282 bp
Antitoxin
Download Length: 152 a.a. Molecular weight: 16369.88 Da Isoelectric Point: 10.3612
>AT249269 WP_046568014.1 NZ_CP099623:3941603-3942058 [Paraburkholderia fungorum]
MVIKRSELGSIDFSDIGTGESIPETHPGEILRSEFLEPLGMSVNALALALRVPAPRINDIVRGKRAISADTALRLERYFG
ASAQFWLNLQIAYDLRVATAAAGEQIEREIEPMPRANRPKLPKVSAEHARAAALAASLTGNVTAIKARRKA
MVIKRSELGSIDFSDIGTGESIPETHPGEILRSEFLEPLGMSVNALALALRVPAPRINDIVRGKRAISADTALRLERYFG
ASAQFWLNLQIAYDLRVATAAAGEQIEREIEPMPRANRPKLPKVSAEHARAAALAASLTGNVTAIKARRKA
Download Length: 456 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|