Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5115244..5115824 | Replicon | chromosome |
Accession | NZ_CP099608 | ||
Organism | Pseudomonas moraviensis strain OTU5BARRA1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NF672_RS22665 | Protein ID | WP_252874558.1 |
Coordinates | 5115244..5115522 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NF672_RS22670 | Protein ID | WP_016773085.1 |
Coordinates | 5115537..5115824 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF672_RS22645 (NF672_22645) | 5110820..5110987 | - | 168 | WP_016773090.1 | DUF2474 domain-containing protein | - |
NF672_RS22650 (NF672_22650) | 5111072..5112079 | - | 1008 | WP_042610525.1 | cytochrome d ubiquinol oxidase subunit II | - |
NF672_RS22655 (NF672_22655) | 5112083..5113528 | - | 1446 | WP_042610526.1 | cytochrome ubiquinol oxidase subunit I | - |
NF672_RS22660 (NF672_22660) | 5113909..5115144 | + | 1236 | WP_042610527.1 | MFS transporter | - |
NF672_RS22665 (NF672_22665) | 5115244..5115522 | + | 279 | WP_252874558.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NF672_RS22670 (NF672_22670) | 5115537..5115824 | + | 288 | WP_016773085.1 | HigA family addiction module antitoxin | Antitoxin |
NF672_RS22675 (NF672_22675) | 5115829..5116380 | - | 552 | WP_252873390.1 | DJ-1/PfpI family protein | - |
NF672_RS22680 (NF672_22680) | 5116448..5116894 | - | 447 | WP_042610529.1 | DUF4879 domain-containing protein | - |
NF672_RS22685 (NF672_22685) | 5117115..5118410 | + | 1296 | WP_252873391.1 | NCS2 family permease | - |
NF672_RS22690 (NF672_22690) | 5118407..5119486 | + | 1080 | WP_064364087.1 | tRNA (uridine(54)-C5)-methyltransferase TrmA | - |
NF672_RS22695 (NF672_22695) | 5119541..5119987 | - | 447 | WP_252873392.1 | DUF2442 domain-containing protein | - |
NF672_RS22700 (NF672_22700) | 5119984..5120412 | - | 429 | WP_083353612.1 | DUF4160 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10745.31 Da Isoelectric Point: 9.6228
>T249248 WP_252874558.1 NZ_CP099608:5115244-5115522 [Pseudomonas moraviensis]
MIKSFQHKGLRGFYETGTTRGIRAEHAKRLSRMLQFMDRATLPGDLDLPGWRLHPLKGELSEHWSLSVSGNWRVIFRFVG
SDIELVDYLDYH
MIKSFQHKGLRGFYETGTTRGIRAEHAKRLSRMLQFMDRATLPGDLDLPGWRLHPLKGELSEHWSLSVSGNWRVIFRFVG
SDIELVDYLDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|