Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 294077..294681 | Replicon | chromosome |
Accession | NZ_CP099608 | ||
Organism | Pseudomonas moraviensis strain OTU5BARRA1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NF672_RS01270 | Protein ID | WP_064363397.1 |
Coordinates | 294367..294681 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1N7CI26 |
Locus tag | NF672_RS01265 | Protein ID | WP_064363398.1 |
Coordinates | 294077..294364 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF672_RS01245 (NF672_01245) | 289852..290256 | + | 405 | WP_042608583.1 | S4 domain-containing protein | - |
NF672_RS01250 (NF672_01250) | 290415..291218 | - | 804 | WP_159244943.1 | phosphatase PAP2 family protein | - |
NF672_RS01255 (NF672_01255) | 291325..292227 | + | 903 | WP_252873705.1 | Hsp33 family molecular chaperone HslO | - |
NF672_RS01260 (NF672_01260) | 292409..293950 | + | 1542 | WP_016772179.1 | phosphoenolpyruvate carboxykinase | - |
NF672_RS01265 (NF672_01265) | 294077..294364 | - | 288 | WP_064363398.1 | NadS family protein | Antitoxin |
NF672_RS01270 (NF672_01270) | 294367..294681 | - | 315 | WP_064363397.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NF672_RS01275 (NF672_01275) | 294787..295086 | - | 300 | WP_064363396.1 | hypothetical protein | - |
NF672_RS01280 (NF672_01280) | 295432..296574 | - | 1143 | WP_252873706.1 | hypothetical protein | - |
NF672_RS01285 (NF672_01285) | 296872..298806 | + | 1935 | WP_083353978.1 | ATP-dependent DNA helicase RecQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11614.29 Da Isoelectric Point: 9.8054
>T249240 WP_064363397.1 NZ_CP099608:c294681-294367 [Pseudomonas moraviensis]
MIFIETSVFTRRVRELLDDDAYATFQKQLVADPSIGDVIEGTGGVRKARVASKGHGKRGGAGVIYYHFVSASQIALLMIY
SKNEQQDLTHDERKALKAMIGNWR
MIFIETSVFTRRVRELLDDDAYATFQKQLVADPSIGDVIEGTGGVRKARVASKGHGKRGGAGVIYYHFVSASQIALLMIY
SKNEQQDLTHDERKALKAMIGNWR
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|