Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 4793158..4793813 | Replicon | chromosome |
Accession | NZ_CP099602 | ||
Organism | Pseudomonas siliginis strain OTU6MONTID1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NF680_RS21300 | Protein ID | WP_252876871.1 |
Coordinates | 4793469..4793813 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NF680_RS21295 | Protein ID | WP_041479944.1 |
Coordinates | 4793158..4793472 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF680_RS21275 (NF680_21275) | 4789173..4790345 | - | 1173 | WP_252876869.1 | aspartate aminotransferase family protein | - |
NF680_RS21280 (NF680_21280) | 4790448..4791374 | + | 927 | WP_252876870.1 | LysR family transcriptional regulator | - |
NF680_RS21285 (NF680_21285) | 4791509..4792210 | + | 702 | WP_016773307.1 | hypothetical protein | - |
NF680_RS21290 (NF680_21290) | 4792479..4792970 | - | 492 | WP_016773306.1 | RidA family protein | - |
NF680_RS21295 (NF680_21295) | 4793158..4793472 | - | 315 | WP_041479944.1 | helix-turn-helix domain-containing protein | Antitoxin |
NF680_RS21300 (NF680_21300) | 4793469..4793813 | - | 345 | WP_252876871.1 | toxin | Toxin |
NF680_RS21305 (NF680_21305) | 4793929..4794816 | - | 888 | WP_016773305.1 | heme o synthase | - |
NF680_RS21310 (NF680_21310) | 4794827..4795162 | - | 336 | WP_011335842.1 | cytochrome o ubiquinol oxidase subunit IV | - |
NF680_RS21315 (NF680_21315) | 4795162..4795785 | - | 624 | WP_016773303.1 | cytochrome o ubiquinol oxidase subunit III | - |
NF680_RS21320 (NF680_21320) | 4795789..4797819 | - | 2031 | WP_041479948.1 | cytochrome o ubiquinol oxidase subunit I | - |
NF680_RS21325 (NF680_21325) | 4797823..4798764 | - | 942 | WP_024014231.1 | ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13553.51 Da Isoelectric Point: 10.3452
>T249238 WP_252876871.1 NZ_CP099602:c4793813-4793469 [Pseudomonas siliginis]
MRTIFFETTIFTKSVGRYLTDDEYRTLQNYLQSNPLAGDVMPRTGGFRKLRWADSRRSKGRRGGLRVLYYWLMNDGQFWM
FAIYDKDELEKLTAEQERALRTAIDKELKKRGTP
MRTIFFETTIFTKSVGRYLTDDEYRTLQNYLQSNPLAGDVMPRTGGFRKLRWADSRRSKGRRGGLRVLYYWLMNDGQFWM
FAIYDKDELEKLTAEQERALRTAIDKELKKRGTP
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|