Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 4794091..4794746 | Replicon | chromosome |
Accession | NZ_CP099601 | ||
Organism | Pseudomonas siliginis strain OTU6MONEA1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NF679_RS21470 | Protein ID | WP_252868262.1 |
Coordinates | 4794402..4794746 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NF679_RS21465 | Protein ID | WP_041479944.1 |
Coordinates | 4794091..4794405 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF679_RS21440 (NF679_21440) | 4789576..4790748 | - | 1173 | WP_252868259.1 | aspartate aminotransferase family protein | - |
NF679_RS21445 (NF679_21445) | 4790851..4791771 | + | 921 | WP_252868260.1 | LysR family transcriptional regulator | - |
NF679_RS21450 (NF679_21450) | 4791810..4792214 | + | 405 | WP_252868261.1 | GNAT family N-acetyltransferase | - |
NF679_RS21455 (NF679_21455) | 4792348..4793049 | + | 702 | WP_016773307.1 | hypothetical protein | - |
NF679_RS21460 (NF679_21460) | 4793412..4793903 | - | 492 | WP_016773306.1 | RidA family protein | - |
NF679_RS21465 (NF679_21465) | 4794091..4794405 | - | 315 | WP_041479944.1 | helix-turn-helix domain-containing protein | Antitoxin |
NF679_RS21470 (NF679_21470) | 4794402..4794746 | - | 345 | WP_252868262.1 | toxin | Toxin |
NF679_RS21475 (NF679_21475) | 4794862..4795749 | - | 888 | WP_016773305.1 | heme o synthase | - |
NF679_RS21480 (NF679_21480) | 4795760..4796095 | - | 336 | WP_011335842.1 | cytochrome o ubiquinol oxidase subunit IV | - |
NF679_RS21485 (NF679_21485) | 4796095..4796718 | - | 624 | WP_024014230.1 | cytochrome o ubiquinol oxidase subunit III | - |
NF679_RS21490 (NF679_21490) | 4796722..4798752 | - | 2031 | WP_041479948.1 | cytochrome o ubiquinol oxidase subunit I | - |
NF679_RS21495 (NF679_21495) | 4798756..4799697 | - | 942 | WP_024014231.1 | ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13611.55 Da Isoelectric Point: 10.1973
>T249229 WP_252868262.1 NZ_CP099601:c4794746-4794402 [Pseudomonas siliginis]
MRTIFFETTIFTKSVDRYLTDDEYRTLQNYLQSNPLAGDVMPRTGGFRKLRWADSRRSKGRRGGLRVLYYWLMNDGQFWM
FAIYDKDELEKLTAEQERALRTAIDKELKKRGTP
MRTIFFETTIFTKSVDRYLTDDEYRTLQNYLQSNPLAGDVMPRTGGFRKLRWADSRRSKGRRGGLRVLYYWLMNDGQFWM
FAIYDKDELEKLTAEQERALRTAIDKELKKRGTP
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|