Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5064981..5065561 | Replicon | chromosome |
Accession | NZ_CP099600 | ||
Organism | Pseudomonas siliginis strain OTU6MEDAA1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A554AH63 |
Locus tag | NF678_RS22425 | Protein ID | WP_041477766.1 |
Coordinates | 5064981..5065259 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NF678_RS22430 | Protein ID | WP_016773085.1 |
Coordinates | 5065274..5065561 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF678_RS22405 (NF678_22405) | 5060467..5060634 | - | 168 | WP_016773090.1 | DUF2474 domain-containing protein | - |
NF678_RS22410 (NF678_22410) | 5060719..5061726 | - | 1008 | WP_016773089.1 | cytochrome d ubiquinol oxidase subunit II | - |
NF678_RS22415 (NF678_22415) | 5061730..5063175 | - | 1446 | WP_041477768.1 | cytochrome ubiquinol oxidase subunit I | - |
NF678_RS22420 (NF678_22420) | 5063645..5064880 | + | 1236 | WP_252882711.1 | MFS transporter | - |
NF678_RS22425 (NF678_22425) | 5064981..5065259 | + | 279 | WP_041477766.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NF678_RS22430 (NF678_22430) | 5065274..5065561 | + | 288 | WP_016773085.1 | HigA family addiction module antitoxin | Antitoxin |
NF678_RS22435 (NF678_22435) | 5065566..5066117 | - | 552 | WP_150742273.1 | DJ-1/PfpI family protein | - |
NF678_RS22440 (NF678_22440) | 5066185..5066631 | - | 447 | WP_252868318.1 | DUF4879 domain-containing protein | - |
NF678_RS22445 (NF678_22445) | 5066852..5068147 | + | 1296 | WP_016773083.1 | NCS2 family permease | - |
NF678_RS22450 (NF678_22450) | 5068144..5069223 | + | 1080 | WP_252882712.1 | tRNA (uridine(54)-C5)-methyltransferase TrmA | - |
NF678_RS22455 (NF678_22455) | 5069494..5069934 | + | 441 | WP_252882713.1 | type II 3-dehydroquinate dehydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10771.34 Da Isoelectric Point: 9.5056
>T249219 WP_041477766.1 NZ_CP099600:5064981-5065259 [Pseudomonas siliginis]
MIKSFQHKGLRGFYETGTTRGIRADHAKRLSRMLQFMDRATLPADLDLPGWRLHPLKGELSEYWSLSVSGNWRVIFRFVG
SDIELVDYLDYH
MIKSFQHKGLRGFYETGTTRGIRADHAKRLSRMLQFMDRATLPADLDLPGWRLHPLKGELSEYWSLSVSGNWRVIFRFVG
SDIELVDYLDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|