Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5110842..5111422 | Replicon | chromosome |
Accession | NZ_CP099599 | ||
Organism | Pseudomonas siliginis strain OTU6ESPEB1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A554AH63 |
Locus tag | NF677_RS22845 | Protein ID | WP_041477766.1 |
Coordinates | 5110842..5111120 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NF677_RS22850 | Protein ID | WP_016773085.1 |
Coordinates | 5111135..5111422 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF677_RS22825 (NF677_22825) | 5106326..5106493 | - | 168 | WP_016773090.1 | DUF2474 domain-containing protein | - |
NF677_RS22830 (NF677_22830) | 5106578..5107585 | - | 1008 | WP_016773089.1 | cytochrome d ubiquinol oxidase subunit II | - |
NF677_RS22835 (NF677_22835) | 5107589..5109034 | - | 1446 | WP_024014409.1 | cytochrome ubiquinol oxidase subunit I | - |
NF677_RS22840 (NF677_22840) | 5109506..5110741 | + | 1236 | WP_252884863.1 | MFS transporter | - |
NF677_RS22845 (NF677_22845) | 5110842..5111120 | + | 279 | WP_041477766.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NF677_RS22850 (NF677_22850) | 5111135..5111422 | + | 288 | WP_016773085.1 | HigA family addiction module antitoxin | Antitoxin |
NF677_RS22855 (NF677_22855) | 5111427..5111978 | - | 552 | WP_041477765.1 | DJ-1/PfpI family protein | - |
NF677_RS22860 (NF677_22860) | 5112046..5112492 | - | 447 | WP_252868318.1 | DUF4879 domain-containing protein | - |
NF677_RS22865 (NF677_22865) | 5112713..5114008 | + | 1296 | WP_016773083.1 | NCS2 family permease | - |
NF677_RS22870 (NF677_22870) | 5114005..5115084 | + | 1080 | WP_252882712.1 | tRNA (uridine(54)-C5)-methyltransferase TrmA | - |
NF677_RS22875 (NF677_22875) | 5115139..5115585 | - | 447 | WP_252884864.1 | DUF2442 domain-containing protein | - |
NF677_RS22880 (NF677_22880) | 5115582..5116010 | - | 429 | WP_252884865.1 | DUF4160 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10771.34 Da Isoelectric Point: 9.5056
>T249213 WP_041477766.1 NZ_CP099599:5110842-5111120 [Pseudomonas siliginis]
MIKSFQHKGLRGFYETGTTRGIRADHAKRLSRMLQFMDRATLPADLDLPGWRLHPLKGELSEYWSLSVSGNWRVIFRFVG
SDIELVDYLDYH
MIKSFQHKGLRGFYETGTTRGIRADHAKRLSRMLQFMDRATLPADLDLPGWRLHPLKGELSEYWSLSVSGNWRVIFRFVG
SDIELVDYLDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|