Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 4840174..4840829 | Replicon | chromosome |
Accession | NZ_CP099599 | ||
Organism | Pseudomonas siliginis strain OTU6ESPEB1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A554AC95 |
Locus tag | NF677_RS21550 | Protein ID | WP_041479945.1 |
Coordinates | 4840485..4840829 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NF677_RS21545 | Protein ID | WP_041479944.1 |
Coordinates | 4840174..4840488 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF677_RS21525 (NF677_21525) | 4836202..4837374 | - | 1173 | WP_252878859.1 | aspartate aminotransferase family protein | - |
NF677_RS21530 (NF677_21530) | 4837477..4838403 | + | 927 | WP_236168923.1 | LysR family transcriptional regulator | - |
NF677_RS21535 (NF677_21535) | 4838538..4839239 | + | 702 | WP_016773307.1 | hypothetical protein | - |
NF677_RS21540 (NF677_21540) | 4839497..4839988 | - | 492 | WP_016773306.1 | RidA family protein | - |
NF677_RS21545 (NF677_21545) | 4840174..4840488 | - | 315 | WP_041479944.1 | helix-turn-helix domain-containing protein | Antitoxin |
NF677_RS21550 (NF677_21550) | 4840485..4840829 | - | 345 | WP_041479945.1 | hypothetical protein | Toxin |
NF677_RS21555 (NF677_21555) | 4840945..4841832 | - | 888 | WP_016773305.1 | heme o synthase | - |
NF677_RS21560 (NF677_21560) | 4841843..4842178 | - | 336 | WP_011335842.1 | cytochrome o ubiquinol oxidase subunit IV | - |
NF677_RS21565 (NF677_21565) | 4842178..4842801 | - | 624 | WP_016773303.1 | cytochrome o ubiquinol oxidase subunit III | - |
NF677_RS21570 (NF677_21570) | 4842805..4844835 | - | 2031 | WP_041479948.1 | cytochrome o ubiquinol oxidase subunit I | - |
NF677_RS21575 (NF677_21575) | 4844839..4845780 | - | 942 | WP_024014231.1 | ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13523.49 Da Isoelectric Point: 10.3452
>T249212 WP_041479945.1 NZ_CP099599:c4840829-4840485 [Pseudomonas siliginis]
MRTIFFETTIFTKSVGRYLTDDEYRTLQNYLQSNPLAGDVMPRTGGFRKLRWADSRRGKGRRGGLRVLYYWLMNDGQFWM
FAIYDKDELEKLTAEQERALRTAIDKELKKRGTP
MRTIFFETTIFTKSVGRYLTDDEYRTLQNYLQSNPLAGDVMPRTGGFRKLRWADSRRGKGRRGGLRVLYYWLMNDGQFWM
FAIYDKDELEKLTAEQERALRTAIDKELKKRGTP
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|