Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/- |
| Location | 4830942..4831597 | Replicon | chromosome |
| Accession | NZ_CP099598 | ||
| Organism | Pseudomonas siliginis strain OTU6BANIB1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NF676_RS22125 | Protein ID | WP_252886777.1 |
| Coordinates | 4831253..4831597 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NF676_RS22120 | Protein ID | WP_041479944.1 |
| Coordinates | 4830942..4831256 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF676_RS22100 (NF676_22105) | 4826865..4828037 | - | 1173 | WP_252886775.1 | aspartate aminotransferase family protein | - |
| NF676_RS22105 (NF676_22110) | 4828140..4829066 | + | 927 | WP_252886776.1 | LysR family transcriptional regulator | - |
| NF676_RS22110 (NF676_22115) | 4829201..4829902 | + | 702 | WP_016773307.1 | hypothetical protein | - |
| NF676_RS22115 (NF676_22120) | 4830263..4830754 | - | 492 | WP_016773306.1 | RidA family protein | - |
| NF676_RS22120 (NF676_22125) | 4830942..4831256 | - | 315 | WP_041479944.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NF676_RS22125 (NF676_22130) | 4831253..4831597 | - | 345 | WP_252886777.1 | toxin | Toxin |
| NF676_RS22130 (NF676_22135) | 4831713..4832600 | - | 888 | WP_016773305.1 | heme o synthase | - |
| NF676_RS22135 (NF676_22140) | 4832611..4832946 | - | 336 | WP_011335842.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| NF676_RS22140 (NF676_22145) | 4832946..4833569 | - | 624 | WP_024014230.1 | cytochrome o ubiquinol oxidase subunit III | - |
| NF676_RS22145 (NF676_22150) | 4833573..4835603 | - | 2031 | WP_041479948.1 | cytochrome o ubiquinol oxidase subunit I | - |
| NF676_RS22150 (NF676_22155) | 4835607..4836548 | - | 942 | WP_024014231.1 | ubiquinol oxidase subunit II | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13440.41 Da Isoelectric Point: 10.2002
>T249206 WP_252886777.1 NZ_CP099598:c4831597-4831253 [Pseudomonas siliginis]
MRTIFFETTIFTKSVGRYLTDDEYRTLQNYLQSNPLAGDVMPRTGGFRKLRWADSRRGKGRRGGLRVLYYCLMNDGQFWM
FAIYDKDELEKLTAEQERALRTAIDKELKKRGTP
MRTIFFETTIFTKSVGRYLTDDEYRTLQNYLQSNPLAGDVMPRTGGFRKLRWADSRRGKGRRGGLRVLYYCLMNDGQFWM
FAIYDKDELEKLTAEQERALRTAIDKELKKRGTP
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|