Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 4857411..4858066 | Replicon | chromosome |
Accession | NZ_CP099596 | ||
Organism | Pseudomonas siliginis strain OTU6BAGNBB1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A554AC95 |
Locus tag | NF675_RS21225 | Protein ID | WP_041479945.1 |
Coordinates | 4857722..4858066 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NF675_RS21220 | Protein ID | WP_041479944.1 |
Coordinates | 4857411..4857725 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF675_RS21200 (NF675_21200) | 4853438..4854610 | - | 1173 | WP_252878859.1 | aspartate aminotransferase family protein | - |
NF675_RS21205 (NF675_21205) | 4854713..4855639 | + | 927 | WP_252878860.1 | LysR family transcriptional regulator | - |
NF675_RS21210 (NF675_21210) | 4855774..4856475 | + | 702 | WP_016773307.1 | hypothetical protein | - |
NF675_RS21215 (NF675_21215) | 4856734..4857225 | - | 492 | WP_016773306.1 | RidA family protein | - |
NF675_RS21220 (NF675_21220) | 4857411..4857725 | - | 315 | WP_041479944.1 | helix-turn-helix domain-containing protein | Antitoxin |
NF675_RS21225 (NF675_21225) | 4857722..4858066 | - | 345 | WP_041479945.1 | hypothetical protein | Toxin |
NF675_RS21230 (NF675_21230) | 4858182..4859069 | - | 888 | WP_016773305.1 | heme o synthase | - |
NF675_RS21235 (NF675_21235) | 4859080..4859415 | - | 336 | WP_011335842.1 | cytochrome o ubiquinol oxidase subunit IV | - |
NF675_RS21240 (NF675_21240) | 4859415..4860038 | - | 624 | WP_024014230.1 | cytochrome o ubiquinol oxidase subunit III | - |
NF675_RS21245 (NF675_21245) | 4860042..4862072 | - | 2031 | WP_041479948.1 | cytochrome o ubiquinol oxidase subunit I | - |
NF675_RS21250 (NF675_21250) | 4862076..4863017 | - | 942 | WP_024014231.1 | ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13523.49 Da Isoelectric Point: 10.3452
>T249197 WP_041479945.1 NZ_CP099596:c4858066-4857722 [Pseudomonas siliginis]
MRTIFFETTIFTKSVGRYLTDDEYRTLQNYLQSNPLAGDVMPRTGGFRKLRWADSRRGKGRRGGLRVLYYWLMNDGQFWM
FAIYDKDELEKLTAEQERALRTAIDKELKKRGTP
MRTIFFETTIFTKSVGRYLTDDEYRTLQNYLQSNPLAGDVMPRTGGFRKLRWADSRRGKGRRGGLRVLYYWLMNDGQFWM
FAIYDKDELEKLTAEQERALRTAIDKELKKRGTP
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|