Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3658653..3659347 | Replicon | chromosome |
Accession | NZ_CP099590 | ||
Organism | Escherichia coli strain WG1 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | NHF37_RS17955 | Protein ID | WP_001263489.1 |
Coordinates | 3658653..3659051 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | NHF37_RS17960 | Protein ID | WP_000554758.1 |
Coordinates | 3659054..3659347 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3654241) | 3654241..3654321 | - | 81 | NuclAT_12 | - | - |
- (3654241) | 3654241..3654321 | - | 81 | NuclAT_12 | - | - |
- (3654241) | 3654241..3654321 | - | 81 | NuclAT_12 | - | - |
- (3654241) | 3654241..3654321 | - | 81 | NuclAT_12 | - | - |
NHF37_RS17930 (3654917) | 3654917..3655375 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
NHF37_RS17935 (3655636) | 3655636..3657093 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
NHF37_RS17940 (3657150) | 3657150..3657671 | - | 522 | Protein_3531 | peptide chain release factor H | - |
NHF37_RS17945 (3657667) | 3657667..3657873 | - | 207 | Protein_3532 | RtcB family protein | - |
NHF37_RS17950 (3658191) | 3658191..3658643 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
NHF37_RS17955 (3658653) | 3658653..3659051 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
NHF37_RS17960 (3659054) | 3659054..3659347 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
NHF37_RS17965 (3659399) | 3659399..3660454 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
NHF37_RS17970 (3660525) | 3660525..3661310 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
NHF37_RS17975 (3661282) | 3661282..3662994 | + | 1713 | Protein_3538 | flagellar biosynthesis protein FlhA | - |
NHF37_RS17980 (3663218) | 3663218..3663715 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T249181 WP_001263489.1 NZ_CP099590:c3659051-3658653 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |