Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 714430..715123 | Replicon | chromosome |
Accession | NZ_CP099590 | ||
Organism | Escherichia coli strain WG1 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | NHF37_RS03470 | Protein ID | WP_000415584.1 |
Coordinates | 714430..714726 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | NHF37_RS03475 | Protein ID | WP_000650107.1 |
Coordinates | 714728..715123 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHF37_RS03435 (709518) | 709518..709832 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
NHF37_RS03440 (709863) | 709863..710444 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
NHF37_RS03445 (710763) | 710763..711095 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
NHF37_RS03450 (711141) | 711141..712490 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
NHF37_RS03455 (712487) | 712487..713146 | - | 660 | WP_001221495.1 | quorum sensing response regulator transcription factor QseB | - |
NHF37_RS03460 (713298) | 713298..713690 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
NHF37_RS03465 (713743) | 713743..714225 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
NHF37_RS03470 (714430) | 714430..714726 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
NHF37_RS03475 (714728) | 714728..715123 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
NHF37_RS03480 (715256) | 715256..716863 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
NHF37_RS03485 (717001) | 717001..719259 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T249165 WP_000415584.1 NZ_CP099590:714430-714726 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT249165 WP_000650107.1 NZ_CP099590:714728-715123 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|