Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3663777..3664471 | Replicon | chromosome |
Accession | NZ_CP099588 | ||
Organism | Escherichia coli strain EMG2 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | NHF38_RS17975 | Protein ID | WP_001263489.1 |
Coordinates | 3663777..3664175 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | NHF38_RS17980 | Protein ID | WP_000554758.1 |
Coordinates | 3664178..3664471 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3659365) | 3659365..3659445 | - | 81 | NuclAT_12 | - | - |
- (3659365) | 3659365..3659445 | - | 81 | NuclAT_12 | - | - |
- (3659365) | 3659365..3659445 | - | 81 | NuclAT_12 | - | - |
- (3659365) | 3659365..3659445 | - | 81 | NuclAT_12 | - | - |
NHF38_RS17950 (3660041) | 3660041..3660499 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
NHF38_RS17955 (3660760) | 3660760..3662217 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
NHF38_RS17960 (3662274) | 3662274..3662795 | - | 522 | Protein_3535 | peptide chain release factor H | - |
NHF38_RS17965 (3662791) | 3662791..3662997 | - | 207 | Protein_3536 | RtcB family protein | - |
NHF38_RS17970 (3663315) | 3663315..3663767 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
NHF38_RS17975 (3663777) | 3663777..3664175 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
NHF38_RS17980 (3664178) | 3664178..3664471 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
NHF38_RS17985 (3664523) | 3664523..3665578 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
NHF38_RS17990 (3665649) | 3665649..3666434 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
NHF38_RS17995 (3666406) | 3666406..3668118 | + | 1713 | Protein_3542 | flagellar biosynthesis protein FlhA | - |
NHF38_RS18000 (3668342) | 3668342..3668839 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T249150 WP_001263489.1 NZ_CP099588:c3664175-3663777 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |