Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprG-sprF/-
Location 2270589..2270806 Replicon chromosome
Accession NZ_CP099576
Organism Staphylococcus aureus strain MRSA1369

Toxin (Protein)


Gene name SprG3 Uniprot ID Q2FWA7
Locus tag NHB12_RS11400 Protein ID WP_001802298.1
Coordinates 2270702..2270806 (-) Length 35 a.a.

Antitoxin (RNA)


Gene name SprF4
Locus tag -
Coordinates 2270589..2270644 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NHB12_RS11375 2266726..2267391 - 666 WP_001024094.1 SDR family oxidoreductase -
NHB12_RS11380 2267543..2267863 + 321 WP_000003759.1 Zn(II)-responsive metalloregulatory transcriptional repressor CzrA -
NHB12_RS11385 2267865..2268845 + 981 WP_000019744.1 CDF family zinc efflux transporter CzrB -
NHB12_RS11390 2269111..2270202 + 1092 WP_000495671.1 lytic regulatory protein -
- 2270589..2270644 + 56 - - Antitoxin
NHB12_RS11400 2270702..2270806 - 105 WP_001802298.1 hypothetical protein Toxin
NHB12_RS11405 2270967..2271450 - 484 Protein_2207 recombinase family protein -
NHB12_RS11410 2271493..2272629 - 1137 WP_000115564.1 SAP domain-containing protein -
NHB12_RS11415 2272918..2273010 + 93 WP_001790138.1 hypothetical protein -
NHB12_RS11420 2273299..2273483 + 185 Protein_2210 exotoxin -
NHB12_RS11425 2273715..2274572 - 858 WP_000370924.1 HAD family hydrolase -
NHB12_RS11430 2274640..2275422 - 783 WP_000908176.1 ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 35 a.a.        Molecular weight: 3906.77 Da        Isoelectric Point: 5.5724

>T249123 WP_001802298.1 NZ_CP099576:c2270806-2270702 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK

Download         Length: 105 bp

Antitoxin


Download         Length: 56 bp

>AT249123 NZ_CP099576:2270589-2270644 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y9L9

Antitoxin

Download structure file

References