Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2095922..2096221 | Replicon | chromosome |
| Accession | NZ_CP099576 | ||
| Organism | Staphylococcus aureus strain MRSA1369 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | NHB12_RS10405 | Protein ID | WP_011447039.1 |
| Coordinates | 2096045..2096221 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2095922..2095977 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHB12_RS10365 | 2091253..2091513 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| NHB12_RS10370 | 2091566..2091916 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| NHB12_RS10375 | 2092601..2093050 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| NHB12_RS10380 | 2093145..2093480 | - | 336 | Protein_2007 | SH3 domain-containing protein | - |
| NHB12_RS10385 | 2094130..2094621 | - | 492 | WP_000919350.1 | staphylokinase | - |
| NHB12_RS10390 | 2094812..2095567 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| NHB12_RS10395 | 2095579..2095833 | - | 255 | WP_000611512.1 | phage holin | - |
| NHB12_RS10400 | 2095885..2095992 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2095914..2096053 | + | 140 | NuclAT_0 | - | - |
| - | 2095914..2096053 | + | 140 | NuclAT_0 | - | - |
| - | 2095914..2096053 | + | 140 | NuclAT_0 | - | - |
| - | 2095914..2096053 | + | 140 | NuclAT_0 | - | - |
| - | 2095922..2095977 | + | 56 | - | - | Antitoxin |
| NHB12_RS10405 | 2096045..2096221 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| NHB12_RS10410 | 2096371..2096667 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| NHB12_RS10415 | 2096725..2097012 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| NHB12_RS10420 | 2097059..2097211 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| NHB12_RS10425 | 2097201..2100986 | - | 3786 | WP_000582165.1 | phage tail spike protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2091566..2147514 | 55948 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T249118 WP_011447039.1 NZ_CP099576:c2096221-2096045 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT249118 NZ_CP099576:2095922-2095977 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|