Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1934933..1935115 | Replicon | chromosome |
Accession | NZ_CP099576 | ||
Organism | Staphylococcus aureus strain MRSA1369 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | NHB12_RS09425 | Protein ID | WP_001801861.1 |
Coordinates | 1934933..1935028 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1935056..1935115 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHB12_RS09385 | 1930593..1931219 | + | 627 | Protein_1847 | hypothetical protein | - |
NHB12_RS09390 | 1931260..1931604 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
NHB12_RS09395 | 1931702..1932253 | + | 552 | WP_000414205.1 | hypothetical protein | - |
NHB12_RS09400 | 1932471..1933112 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
NHB12_RS09405 | 1933226..1933411 | - | 186 | WP_000809857.1 | hypothetical protein | - |
NHB12_RS09410 | 1933413..1933589 | - | 177 | WP_000375476.1 | hypothetical protein | - |
NHB12_RS09415 | 1933600..1933983 | - | 384 | WP_000070811.1 | hypothetical protein | - |
NHB12_RS09420 | 1934587..1934730 | - | 144 | WP_001549059.1 | transposase | - |
NHB12_RS09425 | 1934933..1935028 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1935056..1935115 | - | 60 | - | - | Antitoxin |
NHB12_RS09430 | 1935151..1935252 | + | 102 | WP_001791893.1 | hypothetical protein | - |
NHB12_RS09435 | 1935230..1935406 | - | 177 | Protein_1857 | transposase | - |
NHB12_RS09440 | 1935600..1935977 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T249116 WP_001801861.1 NZ_CP099576:1934933-1935028 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT249116 NZ_CP099576:c1935115-1935056 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|