Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 1060769..1061274 | Replicon | chromosome |
Accession | NZ_CP099556 | ||
Organism | Aliarcobacter cryaerophilus strain ICDCAC48 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | A0A494T483 |
Locus tag | NGX11_RS05350 | Protein ID | WP_066157207.1 |
Coordinates | 1061008..1061274 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | A0A1V9VC04 |
Locus tag | NGX11_RS05345 | Protein ID | WP_066157209.1 |
Coordinates | 1060769..1061014 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NGX11_RS05320 (NGX11_05295) | 1055846..1056439 | + | 594 | WP_263514010.1 | M48 family metallopeptidase | - |
NGX11_RS05325 (NGX11_05300) | 1056441..1056881 | - | 441 | WP_187471306.1 | DUF721 domain-containing protein | - |
NGX11_RS05330 (NGX11_05305) | 1056986..1058437 | + | 1452 | WP_263514011.1 | FAD-binding protein | - |
NGX11_RS05335 (NGX11_05310) | 1058491..1060026 | + | 1536 | WP_260892561.1 | glutamine-hydrolyzing GMP synthase | - |
NGX11_RS05340 (NGX11_05315) | 1060265..1060567 | + | 303 | WP_263514012.1 | HNH endonuclease | - |
NGX11_RS05345 (NGX11_05320) | 1060769..1061014 | + | 246 | WP_066157209.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NGX11_RS05350 (NGX11_05325) | 1061008..1061274 | + | 267 | WP_066157207.1 | Txe/YoeB family addiction module toxin | Toxin |
NGX11_RS05355 (NGX11_05330) | 1061284..1062999 | - | 1716 | WP_263514013.1 | protein adenylyltransferase SelO family protein | - |
NGX11_RS05360 (NGX11_05335) | 1063150..1064448 | + | 1299 | WP_141046414.1 | M99 family carboxypeptidase catalytic domain-containing protein | - |
NGX11_RS05365 (NGX11_05340) | 1064473..1064667 | - | 195 | WP_066348707.1 | DUF2892 domain-containing protein | - |
NGX11_RS05370 (NGX11_05345) | 1064828..1065532 | + | 705 | WP_263514014.1 | alpha/beta hydrolase | - |
NGX11_RS05375 (NGX11_05350) | 1065586..1066179 | + | 594 | WP_263514015.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 925490..1118718 | 193228 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10229.96 Da Isoelectric Point: 9.9946
>T249109 WP_066157207.1 NZ_CP099556:1061008-1061274 [Aliarcobacter cryaerophilus]
MVNYKLVYTKQAGKDAKKLSNSGLKSKALELLEIISLNPYQNPPPYEKLIGDLNSAISRRINIQHRLVYEVLEDIKTIKV
IRMWSHYE
MVNYKLVYTKQAGKDAKKLSNSGLKSKALELLEIISLNPYQNPPPYEKLIGDLNSAISRRINIQHRLVYEVLEDIKTIKV
IRMWSHYE
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A494T483 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1V9VC04 |