Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 50778..51031 Replicon plasmid pSZS128-KPC
Accession NZ_CP099524
Organism Klebsiella pneumoniae strain SZS128

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag NG894_RS28380 Protein ID WP_001312851.1
Coordinates 50882..51031 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 50778..50837 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NG894_RS28340 (46438) 46438..46503 - 66 Protein_59 helix-turn-helix domain-containing protein -
NG894_RS28345 (46556) 46556..47260 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
NG894_RS28350 (47285) 47285..47485 + 201 WP_072354025.1 hypothetical protein -
NG894_RS28355 (47505) 47505..48251 + 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -
NG894_RS28360 (48306) 48306..48866 + 561 WP_000139328.1 fertility inhibition protein FinO -
NG894_RS28365 (48998) 48998..49198 + 201 WP_015059022.1 hypothetical protein -
NG894_RS28370 (49584) 49584..50183 + 600 WP_032083981.1 PIN domain-containing protein -
NG894_RS28375 (50245) 50245..50577 + 333 WP_152916585.1 hypothetical protein -
- (50778) 50778..50837 - 60 NuclAT_0 - Antitoxin
- (50778) 50778..50837 - 60 NuclAT_0 - Antitoxin
- (50778) 50778..50837 - 60 NuclAT_0 - Antitoxin
- (50778) 50778..50837 - 60 NuclAT_0 - Antitoxin
NG894_RS28380 (50882) 50882..51031 + 150 WP_001312851.1 Hok/Gef family protein Toxin
NG894_RS28385 (51315) 51315..51563 + 249 WP_000083837.1 replication regulatory protein RepA -
NG894_RS28390 (51678) 51678..51862 + 185 Protein_69 protein CopA/IncA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCTX-M-65 / catA2 / blaKPC-2 - 1..51874 51874


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T249074 WP_001312851.1 NZ_CP099524:50882-51031 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT249074 NZ_CP099524:c50837-50778 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References